Sequence Similarity Clusters for the Entities in PDB 1L7Z

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 91 186 60
95 % 92 190 79 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 105 203 76
70 % 106 205 92
50 % 120 238 105
40 % 142 361 40
30 % 177 432 41
Entity #2 | Chains: B
CAP-23/NAP-22 protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 5NIN 1 A, B Calmodulin 9606
14 4G28 2 R Calmodulin 10116
15 4G27 2 R Calmodulin 10116
16 1G4Y 2 R CALMODULIN 10116
17 4J9Z 2 R Calmodulin 10116
18 2F3Z 1 A Calmodulin 9606
19 1PRW 1 A Calmodulin 9913
20 5JQA 1 A Calmodulin 9606
21 1MXE 1 A, B Calmodulin 7227
22 1YR5 1 A calmodulin residues 1-148 9606
23 5JTH 1 A Calmodulin 9606
24 1CLL 1 A CALMODULIN 9606
25 5V02 2 R Calmodulin-1 9606
26 2WEL 2 D CALMODULIN 9606
27 3BYA 1 A Calmodulin 9606
28 3SJQ 1 A, B Calmodulin 10116
29 5K8Q 1 A Calmodulin 9606
30 4EHQ 1 A Calmodulin 10116
31 4BW7 1 A, C CALMODULIN 9606
32 1AHR 1 A CALMODULIN 9031
33 1IQ5 1 A CALMODULIN 8355
34 5WBX 2 R Calmodulin-1 9606
35 1CM4 1 A CALMODULIN 9913
36 1ZUZ 1 A calmodulin 9606
37 2Y4V 1 A CALMODULIN 9606
38 2HQW 1 A Calmodulin 10116
39 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
40 3SUI 1 A Calmodulin 9606
41 1UP5 1 A, B Calmodulin 9031
42 4BW8 1 A, B CALMODULIN 9606
43 4QNH 2 R Calmodulin 10116
44 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
45 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
46 4Q5U 1 A Calmodulin 9606
47 2BE6 1 A, B, C Calmodulin 2 9606
48 1CDL 1 A, B, C, D CALMODULIN 9606
49 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
50 4DBP 2 C Calmodulin 7227
51 4HEX 1 A, B Calmodulin 10090
52 4M1L 1 A Calmodulin UNP residues 2-149 9606
53 2BCX 1 A Calmodulin 9031
54 1LIN 1 A CALMODULIN 9913
55 3CLN 1 A CALMODULIN 10117
56 1IWQ 1 A CALMODULIN 9606
57 2V01 1 A CALMODULIN 9606
58 1WRZ 1 A calmodulin 9606
59 2YGG 2 B CALMODULIN 10116
60 3L9I 2 C Calmodulin 7227
61 1CM1 1 A CALMODULIN 9913
62 1NIW 1 A, C, E, G calmodulin 10116
63 4CLN 1 A CALMODULIN 7227
64 3G43 1 A, B, C, D Calmodulin 9606
65 1XA5 1 A Calmodulin 9913
66 1OOJ 1 A Calmodulin CMD-1 6239
67 2X0G 2 B CALMODULIN 9606
68 6B8P 2 B, D, F, H Calmodulin-1 9606
69 4DCK 2 B Calmodulin Calmodulin 9606
70 4PJJ 2 B Calmodulin 7227
71 4L79 2 B Calmodulin 9606
72 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
73 5WC5 2 R Calmodulin-1 9606
74 2X51 2 B CALMODULIN 7227
75 6B8N 2 B, D, F, H Calmodulin-1 9606
76 6B8L 2 B, D, F, H Calmodulin-1 9606
77 3BXL 1 A Calmodulin 10116
78 2VB6 2 B CALMODULIN 9031
79 5DBR 1 A Calmodulin 9606
80 3DVE 1 A Calmodulin 9606
81 4DBQ 2 B Calmodulin 7227
82 2BKH 2 B CALMODULIN 7227
83 2V02 1 A CALMODULIN 9606
84 6B8M 2 B, D, F, H Calmodulin-1 9606
85 1QIW 1 A, B CALMODULIN 9913
86 4ZLK 2 B Calmodulin 10090
87 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
88 3EWT 1 A Calmodulin 9606
89 2VAS 2 B CALMODULIN 7227
90 1Y6W 1 A Calmodulin 9606
91 1CTR 1 A CALMODULIN 9606
92 1L7Z 1 A CALMODULIN 9606
93 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
94 4BYF 2 B, D CALMODULIN 9606
95 3DVK 1 A Calmodulin 9606
96 3BXK 1 A, C Calmodulin 10116
97 1QIV 1 A CALMODULIN 9913
98 1A29 1 A CALMODULIN 9913
99 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
100 2FOT 1 A Calmodulin 9913
101 3HR4 2 B, D, F, H Calmodulin 9606
102 6B8Q 2 B, D, F, H Calmodulin-1 9606
103 3GN4 2 B, D, F, H Calmodulin 7227
104 3EWV 1 A Calmodulin 9606
105 3OXQ 1 A, B, C, D Calmodulin 9606
106 1K90 2 D, E, F CALMODULIN 9606
107 4GOW 1 D Calmodulin 9606
108 4ANJ 2 B CALMODULIN 7227
109 4OVN 1 A, B, C, D, E Calmodulin 9606
110 5HIT 1 A Calmodulin 9031
111 5V7X 2 B Calmodulin-1 9606
112 5I0I 2 C Calmodulin 9606
113 5I0I 3 E Calmodulin 9606
114 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
115 4UMO 2 C, D CALMODULIN 9606
116 4JPZ 3 C, I Calmodulin 9606
117 1DEG 1 A CALMODULIN 9913
118 3DVJ 1 A Calmodulin 9606
119 3DVM 1 A Calmodulin 9606
120 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
121 2BKI 2 B, D CALMODULIN 9031
122 1S26 2 D, E, F Calmodulin 9606
123 1SK6 2 D, E, F Calmodulin 9606
124 1K93 2 D, E, F CALMODULIN 9606
125 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
126 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
127 4R8G 2 A, B, H Calmodulin 8355
128 1PK0 2 D, E, F Calmodulin 9606
129 1QX7 1 A, B, I, M, R Calmodulin 10116
130 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
131 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
132 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
133 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
134 4JQ0 2 C Calmodulin 9606
135 1LVC 2 D, E, F calmodulin 9606
136 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
137 6CNM 2 E, F, G, H Calmodulin-1 9606
138 6CNN 2 E, F, G, H Calmodulin-1 9606
139 6CNO 2 E, F, G, H Calmodulin-1 9606
140 6C1D 3 R Calmodulin 32644
141 6C1G 2 R Calmodulin 32644
142 6C1H 3 R Calmodulin 32644
143 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
144 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
145 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
146 5OEO 1 A Calmodulin-1 9606
147 5VMS 2 B Calmodulin 9606
148 5TP5 1 A Calmodulin 9606
149 5TP6 1 A Calmodulin 9606
150 5T0X 1 A Calmodulin 8355
151 5SY1 1 C, D Calmodulin 7108
152 5GGM 1 A Calmodulin 9606
153 5K7L 2 B Calmodulin 9606
154 5J8H 1 A Calmodulin 9606
155 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
156 2N8J 1 A Calmodulin 9606
157 2N27 1 A Calmodulin UNP residues 2-149 9606
158 2MGU 1 A Calmodulin 10116
159 2MG5 1 A Calmodulin UNP residues 2-149 9606
160 2MES 1 A Calmodulin 8355
161 3J41 2 E, F Calmodulin 9606
162 2M55 1 A Calmodulin 9606
163 2M3S 1 A Calmodulin UNP residues 1-149 9031
164 2M0J 1 A Calmodulin 9606
165 2M0K 1 A Calmodulin 9606
166 2LV6 1 A Calmodulin 9606
167 2LL6 1 A Calmodulin 9606
168 2LL7 1 A Calmodulin 9606
169 2LGF 1 A Calmodulin sequence database residues 4-149 9606
170 2L7L 1 A Calmodulin 9606
171 2L53 1 A Calmodulin calmodulin 9606
172 2KNE 1 A Calmodulin 9606
173 2KDU 1 A Calmodulin 8355
174 2K61 1 A Calmodulin 9606
175 2K0J 1 A calmodulin 9606
176 2K0E 1 A Calmodulin 9606
177 2K0F 1 A calmodulin 9606
178 2JZI 1 A Calmodulin 9606
179 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
180 1X02 1 A calmodulin 8355
181 1SY9 1 A CALMODULIN 8355
182 1NWD 1 A Calmodulin 8355
183 1CFF 1 A PROTEIN (CALMODULIN) 8355
184 1CKK 1 A PROTEIN (CALMODULIN) 8355
185 1MUX 1 A CALMODULIN 8355
186 1DMO 1 A CALMODULIN 8355
187 1CFD 1 A CALMODULIN 8355
188 1CFC 1 A CALMODULIN 8355
189 2BBM 1 A CALMODULIN 7227
190 2BBN 1 A CALMODULIN 7227