Sequence Similarity Clusters for the Entities in PDB 1L7Z

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 188 62
95 % 94 192 80 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 107 205 77
70 % 108 207 93
50 % 122 240 107
40 % 144 363 44
30 % 179 434 44
Entity #2 | Chains: B
CAP-23/NAP-22 protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 5NIN 1 A, B Calmodulin 9606
14 4G28 2 R Calmodulin 10116
15 4G27 2 R Calmodulin 10116
16 1G4Y 2 R CALMODULIN 10116
17 4J9Z 2 R Calmodulin 10116
18 2F3Z 1 A Calmodulin 9606
19 1PRW 1 A Calmodulin 9913
20 5JQA 1 A Calmodulin 9606
21 1MXE 1 A, B Calmodulin 7227
22 1YR5 1 A calmodulin residues 1-148 9606
23 5JTH 1 A Calmodulin 9606
24 1CLL 1 A CALMODULIN 9606
25 5V02 2 R Calmodulin-1 9606
26 2WEL 2 D CALMODULIN 9606
27 3BYA 1 A Calmodulin 9606
28 3SJQ 1 A, B Calmodulin 10116
29 5K8Q 1 A Calmodulin 9606
30 4EHQ 1 A Calmodulin 10116
31 4BW7 1 A, C CALMODULIN 9606
32 1AHR 1 A CALMODULIN 9031
33 1IQ5 1 A CALMODULIN 8355
34 5WBX 2 R Calmodulin-1 9606
35 1CM4 1 A CALMODULIN 9913
36 1ZUZ 1 A calmodulin 9606
37 2Y4V 1 A CALMODULIN 9606
38 2HQW 1 A Calmodulin 10116
39 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
40 3SUI 1 A Calmodulin 9606
41 1UP5 1 A, B Calmodulin 9031
42 4BW8 1 A, B CALMODULIN 9606
43 4QNH 2 R Calmodulin 10116
44 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
45 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
46 4Q5U 1 A Calmodulin 9606
47 2BE6 1 A, B, C Calmodulin 2 9606
48 1CDL 1 A, B, C, D CALMODULIN 9606
49 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
50 4DBP 2 C Calmodulin 7227
51 4HEX 1 A, B Calmodulin 10090
52 4M1L 1 A Calmodulin UNP residues 2-149 9606
53 2BCX 1 A Calmodulin 9031
54 1LIN 1 A CALMODULIN 9913
55 3CLN 1 A CALMODULIN 10117
56 1IWQ 1 A CALMODULIN 9606
57 2V01 1 A CALMODULIN 9606
58 1WRZ 1 A calmodulin 9606
59 2YGG 2 B CALMODULIN 10116
60 3L9I 2 C Calmodulin 7227
61 1CM1 1 A CALMODULIN 9913
62 1NIW 1 A, C, E, G calmodulin 10116
63 4CLN 1 A CALMODULIN 7227
64 3G43 1 A, B, C, D Calmodulin 9606
65 6CZQ 2 R Calmodulin-1 residues 5-148 10116
66 1XA5 1 A Calmodulin 9913
67 1OOJ 1 A Calmodulin CMD-1 6239
68 2X0G 2 B CALMODULIN 9606
69 6B8P 2 B, D, F, H Calmodulin-1 9606
70 4DCK 2 B Calmodulin Calmodulin 9606
71 4PJJ 2 B Calmodulin 7227
72 4L79 2 B Calmodulin 9606
73 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
74 5WC5 2 R Calmodulin-1 9606
75 2X51 2 B CALMODULIN 7227
76 6B8N 2 B, D, F, H Calmodulin-1 9606
77 6B8L 2 B, D, F, H Calmodulin-1 9606
78 3BXL 1 A Calmodulin 10116
79 2VB6 2 B CALMODULIN 9031
80 5DBR 1 A Calmodulin 9606
81 3DVE 1 A Calmodulin 9606
82 4DBQ 2 B Calmodulin 7227
83 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
84 2BKH 2 B CALMODULIN 7227
85 2V02 1 A CALMODULIN 9606
86 6B8M 2 B, D, F, H Calmodulin-1 9606
87 1QIW 1 A, B CALMODULIN 9913
88 4ZLK 2 B Calmodulin 10090
89 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
90 3EWT 1 A Calmodulin 9606
91 2VAS 2 B CALMODULIN 7227
92 1Y6W 1 A Calmodulin 9606
93 1CTR 1 A CALMODULIN 9606
94 1L7Z 1 A CALMODULIN 9606
95 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
96 4BYF 2 B, D CALMODULIN 9606
97 3DVK 1 A Calmodulin 9606
98 3BXK 1 A, C Calmodulin 10116
99 1QIV 1 A CALMODULIN 9913
100 1A29 1 A CALMODULIN 9913
101 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
102 2FOT 1 A Calmodulin 9913
103 3HR4 2 B, D, F, H Calmodulin 9606
104 6B8Q 2 B, D, F, H Calmodulin-1 9606
105 3GN4 2 B, D, F, H Calmodulin 7227
106 3EWV 1 A Calmodulin 9606
107 3OXQ 1 A, B, C, D Calmodulin 9606
108 1K90 2 D, E, F CALMODULIN 9606
109 4GOW 1 D Calmodulin 9606
110 4ANJ 2 B CALMODULIN 7227
111 4OVN 1 A, B, C, D, E Calmodulin 9606
112 5HIT 1 A Calmodulin 9031
113 5V7X 2 B Calmodulin-1 9606
114 5I0I 2 C Calmodulin 9606
115 5I0I 3 E Calmodulin 9606
116 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
117 4UMO 2 C, D CALMODULIN 9606
118 4JPZ 3 C, I Calmodulin 9606
119 1DEG 1 A CALMODULIN 9913
120 3DVJ 1 A Calmodulin 9606
121 3DVM 1 A Calmodulin 9606
122 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
123 2BKI 2 B, D CALMODULIN 9031
124 1S26 2 D, E, F Calmodulin 9606
125 1SK6 2 D, E, F Calmodulin 9606
126 1K93 2 D, E, F CALMODULIN 9606
127 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
128 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
129 4R8G 2 A, B, H Calmodulin 8355
130 1PK0 2 D, E, F Calmodulin 9606
131 1QX7 1 A, B, I, M, R Calmodulin 10116
132 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
133 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
134 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
135 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
136 4JQ0 2 C Calmodulin 9606
137 1LVC 2 D, E, F calmodulin 9606
138 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
139 6CNM 2 E, F, G, H Calmodulin-1 9606
140 6CNN 2 E, F, G, H Calmodulin-1 9606
141 6CNO 2 E, F, G, H Calmodulin-1 9606
142 6C1D 3 R Calmodulin 32644
143 6C1G 2 R Calmodulin 32644
144 6C1H 3 R Calmodulin 32644
145 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
146 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
147 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
148 5OEO 1 A Calmodulin-1 9606
149 5VMS 2 B Calmodulin 9606
150 5TP5 1 A Calmodulin 9606
151 5TP6 1 A Calmodulin 9606
152 5T0X 1 A Calmodulin 8355
153 5SY1 1 C, D Calmodulin 7108
154 5GGM 1 A Calmodulin 9606
155 5K7L 2 B Calmodulin 9606
156 5J8H 1 A Calmodulin 9606
157 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
158 2N8J 1 A Calmodulin 9606
159 2N27 1 A Calmodulin UNP residues 2-149 9606
160 2MGU 1 A Calmodulin 10116
161 2MG5 1 A Calmodulin UNP residues 2-149 9606
162 2MES 1 A Calmodulin 8355
163 3J41 2 E, F Calmodulin 9606
164 2M55 1 A Calmodulin 9606
165 2M3S 1 A Calmodulin UNP residues 1-149 9031
166 2M0J 1 A Calmodulin 9606
167 2M0K 1 A Calmodulin 9606
168 2LV6 1 A Calmodulin 9606
169 2LL6 1 A Calmodulin 9606
170 2LL7 1 A Calmodulin 9606
171 2LGF 1 A Calmodulin sequence database residues 4-149 9606
172 2L7L 1 A Calmodulin 9606
173 2L53 1 A Calmodulin calmodulin 9606
174 2KNE 1 A Calmodulin 9606
175 2KDU 1 A Calmodulin 8355
176 2K61 1 A Calmodulin 9606
177 2K0J 1 A calmodulin 9606
178 2K0E 1 A Calmodulin 9606
179 2K0F 1 A calmodulin 9606
180 2JZI 1 A Calmodulin 9606
181 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
182 1X02 1 A calmodulin 8355
183 1SY9 1 A CALMODULIN 8355
184 1NWD 1 A Calmodulin 8355
185 1CFF 1 A PROTEIN (CALMODULIN) 8355
186 1CKK 1 A Calmodulin-1 8355
187 1MUX 1 A CALMODULIN 8355
188 1DMO 1 A CALMODULIN 8355
189 1CFD 1 A CALMODULIN 8355
190 1CFC 1 A CALMODULIN 8355
191 2BBM 1 A CALMODULIN 7227
192 2BBN 1 A CALMODULIN 7227