Sequence Similarity Clusters for the Entities in PDB 1L7Z

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 94 192 62
95 % 97 199 75 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 110 212 77
70 % 111 214 93
50 % 125 247 106
40 % 147 370 43
30 % 184 443 43
Entity #2 | Chains: B
CAP-23/NAP-22 protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 6DAD 1 A, B Calmodulin-1 9606
14 5NIN 1 A, B Calmodulin 9606
15 4G28 2 R Calmodulin 10116
16 4G27 2 R Calmodulin 10116
17 1G4Y 2 R CALMODULIN 10116
18 4J9Z 2 R Calmodulin 10116
19 2F3Z 1 A Calmodulin 9606
20 1PRW 1 A Calmodulin 9913
21 5JQA 1 A Calmodulin 9606
22 1MXE 1 A, B Calmodulin 7227
23 1YR5 1 A calmodulin residues 1-148 9606
24 5JTH 1 A Calmodulin 9606
25 1CLL 1 A CALMODULIN 9606
26 5V02 2 R Calmodulin-1 9606
27 2WEL 2 D CALMODULIN 9606
28 3BYA 1 A Calmodulin 9606
29 3SJQ 1 A, B Calmodulin 10116
30 5K8Q 1 A Calmodulin 9606
31 4EHQ 1 A Calmodulin 10116
32 4BW7 1 A, C CALMODULIN 9606
33 1AHR 1 A CALMODULIN 9031
34 1IQ5 1 A CALMODULIN 8355
35 5WBX 2 R Calmodulin-1 9606
36 1CM4 1 A CALMODULIN 9913
37 1ZUZ 1 A calmodulin 9606
38 2Y4V 1 A CALMODULIN 9606
39 6DAE 1 A, B Calmodulin-1 9606
40 2HQW 1 A Calmodulin 10116
41 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
42 3SUI 1 A Calmodulin 9606
43 1UP5 1 A, B Calmodulin 9031
44 4BW8 1 A, B CALMODULIN 9606
45 4QNH 2 R Calmodulin 10116
46 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
47 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
48 4Q5U 1 A Calmodulin 9606
49 2BE6 1 A, B, C Calmodulin 2 9606
50 1CDL 1 A, B, C, D CALMODULIN 9606
51 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
52 4DBP 2 C Calmodulin 7227
53 4HEX 1 A, B Calmodulin 10090
54 4M1L 1 A Calmodulin UNP residues 2-149 9606
55 2BCX 1 A Calmodulin 9031
56 1LIN 1 A CALMODULIN 9913
57 3CLN 1 A CALMODULIN 10117
58 1IWQ 1 A CALMODULIN 9606
59 2V01 1 A CALMODULIN 9606
60 1WRZ 1 A calmodulin 9606
61 2YGG 2 B CALMODULIN 10116
62 3L9I 2 C Calmodulin 7227
63 1CM1 1 A CALMODULIN 9913
64 1NIW 1 A, C, E, G calmodulin 10116
65 4CLN 1 A CALMODULIN 7227
66 3G43 1 A, B, C, D Calmodulin 9606
67 6CZQ 2 R Calmodulin-1 residues 5-148 10116
68 1XA5 1 A Calmodulin 9913
69 1OOJ 1 A Calmodulin CMD-1 6239
70 2X0G 2 B CALMODULIN 9606
71 6B8P 2 B, D, F, H Calmodulin-1 9606
72 4DCK 2 B Calmodulin Calmodulin 9606
73 4PJJ 2 B Calmodulin 7227
74 4L79 2 B Calmodulin 9606
75 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
76 5WC5 2 R Calmodulin-1 9606
77 2X51 2 B CALMODULIN 7227
78 6B8N 2 B, D, F, H Calmodulin-1 9606
79 6B8L 2 B, D, F, H Calmodulin-1 9606
80 3BXL 1 A Calmodulin 10116
81 2VB6 2 B CALMODULIN 9031
82 5DBR 1 A Calmodulin 9606
83 3DVE 1 A Calmodulin 9606
84 4DBQ 2 B Calmodulin 7227
85 6DAF 1 A, B Calmodulin-1 9606
86 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
87 2BKH 2 B CALMODULIN 7227
88 2V02 1 A CALMODULIN 9606
89 6B8M 2 B, D, F, H Calmodulin-1 9606
90 1QIW 1 A, B CALMODULIN 9913
91 4ZLK 2 B Calmodulin 10090
92 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
93 3EWT 1 A Calmodulin 9606
94 2VAS 2 B CALMODULIN 7227
95 1Y6W 1 A Calmodulin 9606
96 1CTR 1 A CALMODULIN 9606
97 1L7Z 1 A CALMODULIN 9606
98 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
99 4BYF 2 B, D CALMODULIN 9606
100 6DAH 1 A, B, C, D Calmodulin-1 9606
101 3DVK 1 A Calmodulin 9606
102 3BXK 1 A, C Calmodulin 10116
103 1QIV 1 A CALMODULIN 9913
104 1A29 1 A CALMODULIN 9913
105 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
106 2FOT 1 A Calmodulin 9913
107 3HR4 2 B, D, F, H Calmodulin 9606
108 6B8Q 2 B, D, F, H Calmodulin-1 9606
109 3GN4 2 B, D, F, H Calmodulin 7227
110 3EWV 1 A Calmodulin 9606
111 3OXQ 1 A, B, C, D Calmodulin 9606
112 1K90 2 D, E, F CALMODULIN 9606
113 4GOW 1 D Calmodulin 9606
114 4ANJ 2 B CALMODULIN 7227
115 4OVN 1 A, B, C, D, E Calmodulin 9606
116 5HIT 1 A Calmodulin 9031
117 5V7X 2 B Calmodulin-1 9606
118 5I0I 2 C Calmodulin 9606
119 5I0I 3 E Calmodulin 9606
120 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
121 4UMO 2 C, D CALMODULIN 9606
122 4JPZ 3 C, I Calmodulin 9606
123 1DEG 1 A CALMODULIN 9913
124 3DVJ 1 A Calmodulin 9606
125 3DVM 1 A Calmodulin 9606
126 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
127 2BKI 2 B, D CALMODULIN 9031
128 1S26 2 D, E, F Calmodulin 9606
129 1SK6 2 D, E, F Calmodulin 9606
130 1K93 2 D, E, F CALMODULIN 9606
131 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
132 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
133 4R8G 2 A, B, H Calmodulin 8355
134 1PK0 2 D, E, F Calmodulin 9606
135 1QX7 1 A, B, I, M, R Calmodulin 10116
136 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
137 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
138 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
139 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
140 4JQ0 2 C Calmodulin 9606
141 1LVC 2 D, E, F calmodulin 9606
142 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
143 6E2F 2 E Calmodulin-1 9606
144 6E2G 2 E Calmodulin-1 9606
145 6GDK 1 A Calmodulin-1 9606
146 6CNM 2 E, F, G, H Calmodulin-1 9606
147 6CNN 2 E, F, G, H Calmodulin-1 9606
148 6CNO 2 E, F, G, H Calmodulin-1 9606
149 6C1D 3 R Calmodulin 32644
150 6C1G 2 R Calmodulin 32644
151 6C1H 3 R Calmodulin 32644
152 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
153 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
154 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
155 5OEO 1 A Calmodulin-1 9606
156 5VMS 2 B Calmodulin 9606
157 5TP5 1 A Calmodulin 9606
158 5TP6 1 A Calmodulin 9606
159 5T0X 1 A Calmodulin 8355
160 5SY1 1 C, D Calmodulin 7108
161 5GGM 1 A Calmodulin 9606
162 5K7L 2 B Calmodulin 9606
163 5J8H 1 A Calmodulin 9606
164 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
165 2N8J 1 A Calmodulin 9606
166 2N27 1 A Calmodulin UNP residues 2-149 9606
167 2MGU 1 A Calmodulin 10116
168 2MG5 1 A Calmodulin UNP residues 2-149 9606
169 2MES 1 A Calmodulin 8355
170 3J41 2 E, F Calmodulin 9606
171 2M55 1 A Calmodulin 9606
172 2M3S 1 A Calmodulin UNP residues 1-149 9031
173 2M0J 1 A Calmodulin 9606
174 2M0K 1 A Calmodulin 9606
175 2LV6 1 A Calmodulin 9606
176 2LL6 1 A Calmodulin 9606
177 2LL7 1 A Calmodulin 9606
178 2LGF 1 A Calmodulin sequence database residues 4-149 9606
179 2L7L 1 A Calmodulin 9606
180 2L53 1 A Calmodulin calmodulin 9606
181 2KNE 1 A Calmodulin 9606
182 2KDU 1 A Calmodulin 8355
183 2K61 1 A Calmodulin 9606
184 2K0J 1 A calmodulin 9606
185 2K0E 1 A Calmodulin 9606
186 2K0F 1 A calmodulin 9606
187 2JZI 1 A Calmodulin 9606
188 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
189 1X02 1 A calmodulin 8355
190 1SY9 1 A CALMODULIN 8355
191 1NWD 1 A Calmodulin 8355
192 1CFF 1 A CALMODULIN 8355
193 1CKK 1 A Calmodulin-1 8355
194 1MUX 1 A CALMODULIN 8355
195 1DMO 1 A CALMODULIN 8355
196 1CFD 1 A CALMODULIN 8355
197 1CFC 1 A CALMODULIN 8355
198 2BBM 1 A CALMODULIN 7227
199 2BBN 1 A CALMODULIN 7227