Sequence Similarity Clusters for the Entities in PDB 1L7Z

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 91 186 60
95 % 92 190 79 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.6
PDBFlex
90 % 105 203 77
70 % 106 205 93
50 % 120 238 105
40 % 142 361 40
30 % 177 432 42
Entity #2 | Chains: B
CAP-23/NAP-22 protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 5NIN 1 A, B Calmodulin 9606
14 4G28 2 R Calmodulin 10116
15 4G27 2 R Calmodulin 10116
16 1G4Y 2 R CALMODULIN 10116
17 4J9Z 2 R Calmodulin 10116
18 2F3Z 1 A Calmodulin 9606
19 1PRW 1 A Calmodulin 9913
20 5JQA 1 A Calmodulin 9606
21 1MXE 1 A, B Calmodulin 7227
22 1YR5 1 A calmodulin residues 1-148 9606
23 5JTH 1 A Calmodulin 9606
24 1CLL 1 A CALMODULIN 9606
25 5V02 2 R Calmodulin-1 9606
26 2WEL 2 D CALMODULIN 9606
27 3BYA 1 A Calmodulin 9606
28 3SJQ 1 A, B Calmodulin 10116
29 5K8Q 1 A Calmodulin 9606
30 4EHQ 1 A Calmodulin 10116
31 4BW7 1 A, C CALMODULIN 9606
32 1IQ5 1 A CALMODULIN 8355
33 5WBX 2 R Calmodulin-1 9606
34 1CM4 1 A CALMODULIN 9913
35 1ZUZ 1 A calmodulin 9606
36 2Y4V 1 A CALMODULIN 9606
37 2HQW 1 A Calmodulin 10116
38 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
39 3SUI 1 A Calmodulin 9606
40 1UP5 1 A, B Calmodulin 9031
41 4BW8 1 A, B CALMODULIN 9606
42 4QNH 2 R Calmodulin 10116
43 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
44 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
45 4Q5U 1 A Calmodulin 9606
46 2BE6 1 A, B, C Calmodulin 2 9606
47 1CDL 1 A, B, C, D CALMODULIN 9606
48 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
49 4DBP 2 C Calmodulin 7227
50 4HEX 1 A, B Calmodulin 10090
51 4M1L 1 A Calmodulin UNP residues 2-149 9606
52 2BCX 1 A Calmodulin 9031
53 1LIN 1 A CALMODULIN 9913
54 3CLN 1 A CALMODULIN 10117
55 1IWQ 1 A CALMODULIN 9606
56 2V01 1 A CALMODULIN 9606
57 1WRZ 1 A calmodulin 9606
58 2YGG 2 B CALMODULIN 10116
59 3L9I 2 C Calmodulin 7227
60 1CM1 1 A CALMODULIN 9913
61 1NIW 1 A, C, E, G calmodulin 10116
62 4CLN 1 A CALMODULIN 7227
63 3G43 1 A, B, C, D Calmodulin 9606
64 1XA5 1 A Calmodulin 9913
65 1OOJ 1 A Calmodulin CMD-1 6239
66 2X0G 2 B CALMODULIN 9606
67 6B8P 2 B, D, F, H Calmodulin-1 9606
68 4DCK 2 B Calmodulin Calmodulin 9606
69 4PJJ 2 B Calmodulin 7227
70 4L79 2 B Calmodulin 9606
71 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
72 5WC5 2 R Calmodulin-1 9606
73 2X51 2 B CALMODULIN 7227
74 6B8N 2 B, D, F, H Calmodulin-1 9606
75 6B8L 2 B, D, F, H Calmodulin-1 9606
76 3BXL 1 A Calmodulin 10116
77 2VB6 2 B CALMODULIN 9031
78 5DBR 1 A Calmodulin 9606
79 3DVE 1 A Calmodulin 9606
80 4DBQ 2 B Calmodulin 7227
81 2BKH 2 B CALMODULIN 7227
82 2V02 1 A CALMODULIN 9606
83 6B8M 2 B, D, F, H Calmodulin-1 9606
84 1QIW 1 A, B CALMODULIN 9913
85 4ZLK 2 B Calmodulin 10090
86 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
87 3EWT 1 A Calmodulin 9606
88 2VAS 2 B CALMODULIN 7227
89 1Y6W 1 A Calmodulin 9606
90 1CTR 1 A CALMODULIN 9606
91 1L7Z 1 A CALMODULIN 9606
92 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
93 4BYF 2 B, D CALMODULIN 9606
94 3DVK 1 A Calmodulin 9606
95 3BXK 1 A, C Calmodulin 10116
96 1QIV 1 A CALMODULIN 9913
97 1A29 1 A CALMODULIN 9913
98 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
99 2FOT 1 A Calmodulin 9913
100 3HR4 2 B, D, F, H Calmodulin 9606
101 6B8Q 2 B, D, F, H Calmodulin-1 9606
102 3GN4 2 B, D, F, H Calmodulin 7227
103 3EWV 1 A Calmodulin 9606
104 3OXQ 1 A, B, C, D Calmodulin 9606
105 1K90 2 D, E, F CALMODULIN 9606
106 4GOW 1 D Calmodulin 9606
107 4ANJ 2 B CALMODULIN 7227
108 4OVN 1 A, B, C, D, E Calmodulin 9606
109 5HIT 1 A Calmodulin 9031
110 5V7X 2 B Calmodulin-1 9606
111 5I0I 2 C Calmodulin 9606
112 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
113 4UMO 2 C, D CALMODULIN 9606
114 4JPZ 3 C, I Calmodulin 9606
115 3DVJ 1 A Calmodulin 9606
116 3DVM 1 A Calmodulin 9606
117 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
118 2BKI 2 B, D CALMODULIN 9031
119 1S26 2 D, E, F Calmodulin 9606
120 1SK6 2 D, E, F Calmodulin 9606
121 1K93 2 D, E, F CALMODULIN 9606
122 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
123 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
124 4R8G 2 A, B, H Calmodulin 8355
125 1PK0 2 D, E, F Calmodulin 9606
126 1QX7 1 A, B, I, M, R Calmodulin 10116
127 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
128 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
129 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
130 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
131 4JQ0 2 C Calmodulin 9606
132 1LVC 2 D, E, F calmodulin 9606
133 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
134 6CNM 2 E, F, G, H Calmodulin-1 9606
135 6CNN 2 E, F, G, H Calmodulin-1 9606
136 6CNO 2 E, F, G, H Calmodulin-1 9606
137 6C1D 3 R Calmodulin 32644
138 6C1G 2 R Calmodulin 32644
139 6C1H 3 R Calmodulin 32644
140 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
141 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
142 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
143 5OEO 1 A Calmodulin-1 9606
144 5VMS 2 B Calmodulin 9606
145 5TP5 1 A Calmodulin 9606
146 5TP6 1 A Calmodulin 9606
147 5T0X 1 A Calmodulin 8355
148 5SY1 1 C, D Calmodulin 7108
149 5GGM 1 A Calmodulin 9606
150 5K7L 2 B Calmodulin 9606
151 5J8H 1 A Calmodulin 9606
152 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
153 2N8J 1 A Calmodulin 9606
154 2N27 1 A Calmodulin UNP residues 2-149 9606
155 2MGU 1 A Calmodulin 10116
156 2MG5 1 A Calmodulin UNP residues 2-149 9606
157 2MES 1 A Calmodulin 8355
158 3J41 2 E, F Calmodulin 9606
159 2M55 1 A Calmodulin 9606
160 2M0J 1 A Calmodulin 9606
161 2M0K 1 A Calmodulin 9606
162 2LV6 1 A Calmodulin 9606
163 2LL6 1 A Calmodulin 9606
164 2LL7 1 A Calmodulin 9606
165 2LGF 1 A Calmodulin sequence database residues 4-149 9606
166 2L7L 1 A Calmodulin 9606
167 2L53 1 A Calmodulin calmodulin 9606
168 2KNE 1 A Calmodulin 9606
169 2KDU 1 A Calmodulin 8355
170 2K61 1 A Calmodulin 9606
171 2K0J 1 A calmodulin 9606
172 2K0E 1 A Calmodulin 9606
173 2K0F 1 A calmodulin 9606
174 2JZI 1 A Calmodulin 9606
175 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
176 1X02 1 A calmodulin 8355
177 1SY9 1 A CALMODULIN 8355
178 1NWD 1 A Calmodulin 8355
179 1CFF 1 A PROTEIN (CALMODULIN) 8355
180 1CKK 1 A PROTEIN (CALMODULIN) 8355
181 1MUX 1 A CALMODULIN 8355
182 1DMO 1 A CALMODULIN 8355
183 1CFD 1 A CALMODULIN 8355
184 1CFC 1 A CALMODULIN 8355
185 2BBM 1 A CALMODULIN 7227
186 2BBN 1 A CALMODULIN 7227