Sequence Similarity Clusters for the Entities in PDB 1L7Z

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 93 188 62
95 % 94 192 80 Flexibility: Medium
Max RMSD: 20.3, Avg RMSD: 9.7
PDBFlex
90 % 107 205 77
70 % 108 207 93
50 % 122 240 107
40 % 144 363 44
30 % 179 434 44
Entity #2 | Chains: B
CAP-23/NAP-22 protein, length: 9 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 2O5G 1 A Calmodulin 9031
2 4DJC 1 A Calmodulin 9606
3 3GOF 1 A, B Calmodulin 9031
4 3GP2 1 A Calmodulin 9031
5 4LZX 1 A Calmodulin UNP residues 2-149 9606
6 2W73 1 A, B, E, F CALMODULIN 9606
7 2F3Y 1 A Calmodulin 9606
8 5DOW 1 A, C, E, G Calmodulin 9606
9 4J9Y 2 R Calmodulin 10116
10 2O60 1 A Calmodulin 9031
11 5V03 2 R Calmodulin 9606
12 3IF7 1 A Calmodulin 9913
13 5NIN 1 A, B Calmodulin 9606
14 4G28 2 R Calmodulin 10116
15 4G27 2 R Calmodulin 10116
16 1G4Y 2 R CALMODULIN 10116
17 4J9Z 2 R Calmodulin 10116
18 2F3Z 1 A Calmodulin 9606
19 1PRW 1 A Calmodulin 9913
20 5JQA 1 A Calmodulin 9606
21 1MXE 1 A, B Calmodulin 7227
22 1YR5 1 A calmodulin residues 1-148 9606
23 5JTH 1 A Calmodulin 9606
24 1CLL 1 A CALMODULIN 9606
25 5V02 2 R Calmodulin-1 9606
26 2WEL 2 D CALMODULIN 9606
27 3BYA 1 A Calmodulin 9606
28 3SJQ 1 A, B Calmodulin 10116
29 5K8Q 1 A Calmodulin 9606
30 4EHQ 1 A Calmodulin 10116
31 4BW7 1 A, C CALMODULIN 9606
32 1IQ5 1 A CALMODULIN 8355
33 5WBX 2 R Calmodulin-1 9606
34 1CM4 1 A CALMODULIN 9913
35 1ZUZ 1 A calmodulin 9606
36 2Y4V 1 A CALMODULIN 9606
37 2HQW 1 A Calmodulin 10116
38 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
39 3SUI 1 A Calmodulin 9606
40 1UP5 1 A, B Calmodulin 9031
41 4BW8 1 A, B CALMODULIN 9606
42 4QNH 2 R Calmodulin 10116
43 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
44 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
45 4Q5U 1 A Calmodulin 9606
46 2BE6 1 A, B, C Calmodulin 2 9606
47 1CDL 1 A, B, C, D CALMODULIN 9606
48 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
49 4DBP 2 C Calmodulin 7227
50 4HEX 1 A, B Calmodulin 10090
51 4M1L 1 A Calmodulin UNP residues 2-149 9606
52 2BCX 1 A Calmodulin 9031
53 1LIN 1 A CALMODULIN 9913
54 3CLN 1 A CALMODULIN 10117
55 1IWQ 1 A CALMODULIN 9606
56 2V01 1 A CALMODULIN 9606
57 1WRZ 1 A calmodulin 9606
58 2YGG 2 B CALMODULIN 10116
59 3L9I 2 C Calmodulin 7227
60 1CM1 1 A CALMODULIN 9913
61 1NIW 1 A, C, E, G calmodulin 10116
62 4CLN 1 A CALMODULIN 7227
63 3G43 1 A, B, C, D Calmodulin 9606
64 6CZQ 2 R Calmodulin-1 residues 5-148 10116
65 1XA5 1 A Calmodulin 9913
66 1OOJ 1 A Calmodulin CMD-1 6239
67 2X0G 2 B CALMODULIN 9606
68 6B8P 2 B, D, F, H Calmodulin-1 9606
69 4DCK 2 B Calmodulin Calmodulin 9606
70 4PJJ 2 B Calmodulin 7227
71 4L79 2 B Calmodulin 9606
72 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
73 5WC5 2 R Calmodulin-1 9606
74 2X51 2 B CALMODULIN 7227
75 6B8N 2 B, D, F, H Calmodulin-1 9606
76 6B8L 2 B, D, F, H Calmodulin-1 9606
77 3BXL 1 A Calmodulin 10116
78 2VB6 2 B CALMODULIN 9031
79 5DBR 1 A Calmodulin 9606
80 3DVE 1 A Calmodulin 9606
81 4DBQ 2 B Calmodulin 7227
82 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
83 2BKH 2 B CALMODULIN 7227
84 2V02 1 A CALMODULIN 9606
85 6B8M 2 B, D, F, H Calmodulin-1 9606
86 1QIW 1 A, B CALMODULIN 9913
87 4ZLK 2 B Calmodulin 10090
88 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
89 3EWT 1 A Calmodulin 9606
90 2VAS 2 B CALMODULIN 7227
91 1Y6W 1 A Calmodulin 9606
92 1CTR 1 A CALMODULIN 9606
93 1L7Z 1 A CALMODULIN 9606
94 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
95 4BYF 2 B, D CALMODULIN 9606
96 3DVK 1 A Calmodulin 9606
97 3BXK 1 A, C Calmodulin 10116
98 1QIV 1 A CALMODULIN 9913
99 1A29 1 A CALMODULIN 9913
100 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
101 2FOT 1 A Calmodulin 9913
102 3HR4 2 B, D, F, H Calmodulin 9606
103 6B8Q 2 B, D, F, H Calmodulin-1 9606
104 3GN4 2 B, D, F, H Calmodulin 7227
105 3EWV 1 A Calmodulin 9606
106 3OXQ 1 A, B, C, D Calmodulin 9606
107 1K90 2 D, E, F CALMODULIN 9606
108 4GOW 1 D Calmodulin 9606
109 4ANJ 2 B CALMODULIN 7227
110 4OVN 1 A, B, C, D, E Calmodulin 9606
111 5HIT 1 A Calmodulin 9031
112 5V7X 2 B Calmodulin-1 9606
113 5I0I 2 C Calmodulin 9606
114 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
115 4UMO 2 C, D CALMODULIN 9606
116 4JPZ 3 C, I Calmodulin 9606
117 3DVJ 1 A Calmodulin 9606
118 3DVM 1 A Calmodulin 9606
119 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
120 2BKI 2 B, D CALMODULIN 9031
121 1S26 2 D, E, F Calmodulin 9606
122 1SK6 2 D, E, F Calmodulin 9606
123 1K93 2 D, E, F CALMODULIN 9606
124 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
125 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
126 4R8G 2 A, B, H Calmodulin 8355
127 1PK0 2 D, E, F Calmodulin 9606
128 1QX7 1 A, B, I, M, R Calmodulin 10116
129 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
130 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
131 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
132 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
133 4JQ0 2 C Calmodulin 9606
134 1LVC 2 D, E, F calmodulin 9606
135 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
136 6CNM 2 E, F, G, H Calmodulin-1 9606
137 6CNN 2 E, F, G, H Calmodulin-1 9606
138 6CNO 2 E, F, G, H Calmodulin-1 9606
139 6C1D 3 R Calmodulin 32644
140 6C1G 2 R Calmodulin 32644
141 6C1H 3 R Calmodulin 32644
142 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
143 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
144 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
145 5OEO 1 A Calmodulin-1 9606
146 5VMS 2 B Calmodulin 9606
147 5TP5 1 A Calmodulin 9606
148 5TP6 1 A Calmodulin 9606
149 5T0X 1 A Calmodulin 8355
150 5SY1 1 C, D Calmodulin 7108
151 5GGM 1 A Calmodulin 9606
152 5K7L 2 B Calmodulin 9606
153 5J8H 1 A Calmodulin 9606
154 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
155 2N8J 1 A Calmodulin 9606
156 2N27 1 A Calmodulin UNP residues 2-149 9606
157 2MGU 1 A Calmodulin 10116
158 2MG5 1 A Calmodulin UNP residues 2-149 9606
159 2MES 1 A Calmodulin 8355
160 3J41 2 E, F Calmodulin 9606
161 2M55 1 A Calmodulin 9606
162 2M0J 1 A Calmodulin 9606
163 2M0K 1 A Calmodulin 9606
164 2LV6 1 A Calmodulin 9606
165 2LL6 1 A Calmodulin 9606
166 2LL7 1 A Calmodulin 9606
167 2LGF 1 A Calmodulin sequence database residues 4-149 9606
168 2L7L 1 A Calmodulin 9606
169 2L53 1 A Calmodulin calmodulin 9606
170 2KNE 1 A Calmodulin 9606
171 2KDU 1 A Calmodulin 8355
172 2K61 1 A Calmodulin 9606
173 2K0J 1 A calmodulin 9606
174 2K0E 1 A Calmodulin 9606
175 2K0F 1 A calmodulin 9606
176 2JZI 1 A Calmodulin 9606
177 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
178 1X02 1 A calmodulin 8355
179 1SY9 1 A CALMODULIN 8355
180 1NWD 1 A Calmodulin 8355
181 1CFF 1 A PROTEIN (CALMODULIN) 8355
182 1CKK 1 A Calmodulin-1 8355
183 1MUX 1 A CALMODULIN 8355
184 1DMO 1 A CALMODULIN 8355
185 1CFD 1 A CALMODULIN 8355
186 1CFC 1 A CALMODULIN 8355
187 2BBM 1 A CALMODULIN 7227
188 2BBN 1 A CALMODULIN 7227