Sequence Similarity Clusters for the Entities in PDB 1KXV

Entity #1 | Chains: A,B
ALPHA-AMYLASE, PANCREATIC protein, length: 496 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 6879
95 % 3 17 2607 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.5
PDBFlex
90 % 3 17 2653
70 % 16 77 580
50 % 17 81 591
40 % 17 90 565
30 % 17 90 565
Entity #2 | Chains: C,D
CAMELID VHH DOMAIN CAB10 protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 45565
95 % 1 1 34115 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.5
PDBFlex
90 % 1 1 32616
70 % 1 1 29060
50 % 72 566 7
40 % 103 916 5
30 % 113 1042 7

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 5IVN 1 A BC2-nanobody 30538
2 5E7B 1 A nanobody nano-L06 9838
3 2P45 2 B ANTIBODY CAB-RN05 9838
4 2X1Q 1 A, B GELSOLIN NANOBODY 9844
5 5U64 1 B VHH-28 9838
6 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
7 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
8 4B41 1 A, B ANTIBODY G7 9844
9 5IMM 1 B Nanobody 9835
10 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
11 5NLU 1 A single domain llama antibody Nb36 9844
12 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
13 5IMK 1 B Nanobody 9835
14 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
15 4B50 1 A 2H10 LLAMA VHH 9844
16 2XT1 2 B CAMELID VHH 9 30538
17 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
18 5J1S 3 C VHH domain BS-2 30538
19 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
20 5J1T 3 C VHH domain BS-2 30538
21 2X1O 1 A, B GELSOLIN NANOBODY 9844
22 4QGY 1 A, B nanobody n25, VH domain 9844
23 5C2B 1 H scFv 3B4 heavy chain 9606
24 5DXW 1 A PD-L1 nanobody 10090
25 4N9O 2 B Nanobody Nb484 Nb484 9844
26 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
27 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
28 1T2J 1 A M12-Variable Heavy domain 9606
29 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
30 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
31 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
32 4KML 2 B Nanobody 9844
33 4Z9K 2 B VHH2(F5) antibody 30538
34 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
35 5LMW 1 A Nanobody 9844
36 5NM0 1 A, B, C, D Nb36 9844
37 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
38 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
39 4PPT 1 A Engineered single domain VHH antibody 9844
40 3R0M 1 A, B Llama VHH A12 9844
41 3ZKQ 2 D XA4813 9844
42 4I13 2 B Protein ca1697 (nanobody) 9844
43 5C2U 1 B Nanobody Nanobody 9838
44 1XFP 1 A heavy chain antibody VHH domain 9838
45 4POY 1 A VHH-metal 9844
46 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
47 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
48 5NLW 1 A nanobody Nb36 9844
49 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
50 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
51 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
52 3G9A 2 B Minimizer 9838
53 2P43 2 B ANTIBODY CAB-RN05 9838
54 4KRN 1 A Nanobody/VHH domain EgA1 9844
55 4GFT 2 B Nanobody 9844
56 4TVS 2 a, b VHH Domain BS-1 30538
57 4W6Y 2 B Nanobody NbFedF9 9844
58 1UAC 2 H Ig VH,anti-lysozyme 10090
59 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
60 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
61 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
62 5O02 2 C Nanobody (VHH) Nano-4 30538
63 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
64 4X7F 2 C, D Nano-25 Nanobody 30538
65 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
66 4LGR 2 B Camelid nanobody (VHH3) 30538
67 5J57 2 B VHH single chain antibody V5E1 30538
68 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
69 5OMM 2 C Nanobody (VHH) Nano-14 30538
70 5E03 1 A mouse CTLA-4 nanobody 10090
71 5LZ0 1 A, B PorM nanobody 9844
72 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
73 2XXC 1 B CAMELID VHH 9 30538
74 3QYC 1 A, B VH domain of IgG molecule 9606
75 2XXM 2 B CAMELID VHH 9 30538
76 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
77 5JDS 1 B Nanobody 9835
78 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
79 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
80 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
81 5L21 2 B VHH-C2 30538
82 5FWO 1 A NANOBODY 9844
83 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
84 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
85 3B9V 1 A, B, C, D heavy chain variable domain 9606
86 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
87 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
88 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
89 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
90 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
91 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
92 4POU 2 B VHH Antibody 9844
93 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
94 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
95 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
96 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
97 2P42 2 B, D ANTIBODY CAB-RN05 9838
98 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
99 4QLR 1 A, B Llama nanobody n02 VH domain 9844
100 5J56 2 B VHH single chain antibody V1C7 30538
101 4NBX 2 B A20.1 VHH 9844
102 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
103 4HEP 2 G vHH17 domain 9844
104 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
105 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
106 5IML 2 B Nanobody 9835
107 3A6C 2 H IG VH, anti-lysozyme 10090
108 2DQD 2 H Ig VH,anti-lysozyme 10090
109 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
110 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
111 3A67 2 H IG VH, anti-lysozyme 10090
112 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
113 1J1X 2 H Ig VH,anti-lysozyme 10090
114 5M2J 2 D Anti-(ED-B) scFV 9606
115 2DQC 2 H Ig VH,anti-lysozyme 10090
116 1J1O 2 H Ig VH,anti-lysozyme 10090
117 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
118 4M62 2 H, I GEP2 FV heavy chain 9606
119 5IVO 1 A BC2-nanobody 30538
120 1J1P 2 H Ig VH,anti-lysozyme 10090
121 4NBZ 2 B, D A26.8 VHH 9844
122 5AYU 2 H Ig VH,anti-lysozyme 10090
123 3A6B 2 H IG VH, anti-lysozyme 10090
124 2DQJ 2 H Ig VH,anti-lysozyme 10090
125 5F21 2 B nanobody MU375 9844
126 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
127 2P44 2 B ANTIBODY CAB-RN05 9838
128 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
129 5TP3 1 A, B F-VHH-4 9844
130 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
131 4LHJ 2 B Camelid antibody 30538
132 4BEL 2 D, E XA4813 9844
133 5M7Q 1 A, B Nanobody NbD2 9838
134 5H8D 1 A VHH nanobody 9844
135 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
136 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
137 3DUR 2 B, D Ig-like protein 10090
138 2XV6 2 B, D CAMELID VHH 9 30538
139 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
140 4ZG1 1 A, B, C, D, E, F NB17 9844
141 4I1N 2 B Protein ca1697 (nanobody) 9844
142 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
143 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
144 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
145 4W6X 2 B Nanobody NbFedF7 9844
146 5JA9 2 A, B Nanobody 6 9844
147 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
148 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
149 1OP9 1 A HL6 camel VHH fragment 9838
150 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
151 4LRN 1 H GEP 1 heavy chain 9606
152 4S11 1 A GELSOLIN NANOBODY 9844
153 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
154 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
155 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
156 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
157 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
158 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
159 4Y7M 1 A, B Hi113 protein 9844
160 5JMO 2 C, D camelid VHH fragment 9838
161 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
162 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
163 4B5E 1 A, B PS2-8 9844
164 2DQE 2 H Ig VH,anti-lysozyme 10090
165 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
166 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
167 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
168 4X7C 2 C, D Nano-85 Nanobody VHH 30538
169 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
170 3EBA 1 A CAbHul6 9838
171 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606 3.4.19.13 | Details
172 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
173 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
174 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
175 4I0C 2 C, D cAbHuL5 antibody 9838
176 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
177 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
178 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
179 5BOP 1 A, C Nanobody 9844
180 4DKA 1 A, B single domain antibody VHH 9844
181 5O05 1 C, D Nanobody (VHH) Nano-42 30538
182 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606 3.4.19.13 | Details
183 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
184 3DUU 2 B, D Ig-like protein 10090
185 3K74 2 B Nanobody 9844
186 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
187 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
188 1SJV 1 A r9 llama VHH single domain antibody 9844
189 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
190 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
191 1UA6 2 H Ig VH,anti-lysozyme 10090
192 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
193 4W68 1 A, B Single domain antibody 9844
194 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
195 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
196 3EAK 1 A, B NbBCII10-FGLA 9838
197 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
198 4ORZ 3 C single domain antibody sdAb19 9844
199 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
200 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
201 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
202 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
203 5C1M 2 B Nanobody 39 9844
204 5F7K 2 C, D Nanobody Nb-ER19 9844
205 5LMJ 1 A, B, C, D nanobody 9844
206 5E1H 2 B F8(JOB10) VHH antibody 30538
207 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
208 4OCM 3 C, F Nb1 9844
209 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
210 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
211 4X7E 2 C, D Nano-85 Nanobody 30538
212 5F1O 2 B nanobody MU551 9844
213 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
214 5O03 2 C, D Nanobody (VHH) Nano-32 11983
215 2DQI 2 H Ig VH,anti-lysozyme 10090
216 4Y8D 2 C, D nanobody 9844
217 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
218 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
219 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
220 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
221 4C58 2 B NANOBODY 9844
222 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
223 3DV6 2 B Ig-like protein 10090
224 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
225 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
226 5VXM 2 B Single-domain antibody 20ipaD 30538
227 4XVJ 2 H antibody heavy chain variable domain 9606
228 4IDL 1 A Single Domain Antibody VHH A9 9844
229 1JV5 2 B Ig chain heavy chain precursor V region 9606
230 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
231 3K7U 1 A Antibody 9844
232 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
233 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
234 4NBY 2 B, C A20.1 VHH 9844
235 4X7D 2 C, D Nano-85 Nanobody VHH 9844
236 5F7N 2 C, D Nanobody Nb-ER19 30538
237 5OCL 1 A, C, F, H anti-llama nanobody 30538
238 5OCL 2 B, D, E, G anti-vglut nanobody 9844
239 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
240 2A9M 2 H, I fluorescein-scfv heavy chain 9606
241 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
242 1SJX 1 A immunoglobulin VH domain 9844
243 3ZKS 2 D XA4813 9844
244 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
245 5MY6 2 B Nanobody 2Rs15d 9838
246 3DUS 2 B, D Ig-like protein 10090
247 5M2I 2 G, H, I, J, K, L VHH1 9844
248 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
249 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
250 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
251 3K1K 2 C, D Enhancer 9838
252 4U7S 1 A, B sdAb A3 9844
253 4U3X 1 A, C Human VH domain antibody 9606
254 4W81 1 A Single Domain Antibody 9844
255 5GRV 1 L homo-specific diabody heavy chain 9606
256 5JMR 1 A, B camelid VHH fragment 9838
257 4W70 1 A Single Domain Antibody 9844
258 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
259 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
260 4BFB 2 D, E XA4813 9844
261 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
262 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
263 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
264 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
265 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
266 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
267 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
268 4LHQ 2 B, D Camelid nanobody 30538
269 3DV4 2 B Ig-like protein 10090
270 3ZKX 2 B XA4813 9844
271 3ZKX 3 C XA4815 9844
272 5F1K 2 C, D nanobody MU1053 9844
273 3ZLQ 2 C, D XA4813 9844
274 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
275 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
276 4NC0 2 B A26.8 VHH 9844
277 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
278 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
279 5GS1 2 B, N, P, R heavy chain 9606
280 5F7Y 3 C, D Nanobody Nb-ER19 9844
281 2DQG 2 H Ig VH,anti-lysozyme 10090
282 5IMO 1 B Nanobody 9835
283 5U65 1 A, B VHH-5 9838
284 4TYU 1 A, B Single Domain Antibody 9844
285 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
286 2DQH 2 H Ig VH,anti-lysozyme 10090
287 4AQ1 2 B, D NBKB6 VHH 9844
288 4EIG 2 B CA1698 camel antibody fragment 9844
289 3EHB 3 C FV fragment Chain H 10090
290 3HB3 3 C ANTIBODY FV FRAGMENT 10090
291 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
292 2X89 1 A, B, C ANTIBODY 9838
293 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
294 5O04 2 E, F Nanobody (VHH) Nano-26 30538
295 5O04 3 C, D Nanobody (VHH) Nano-85 30538
296 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
297 3P9W 2 B, D, F, H human VEGF 9606
298 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
299 5F8R 2 C, D Nanobody Nb-ER19 9844
300 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
301 4OCL 3 C, F Nb1 9844
302 4RAV 2 A, C single-chain Fv, VH 9606
303 5LWY 2 H V REGION HEAVY CHAIN 10090
304 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
305 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
306 4IOS 2 D, E, F, G Llama nanobody 11 9844
307 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
308 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
309 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
310 4C57 2 C, D NANOBODY 9844
311 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
312 4OCN 3 C, F Nb1 9844
313 4GRW 3 E, G Nanobody 124C4 9844
314 4GRW 4 F, J Nanobody 37D5 9844
315 4GRW 5 H, I Nanobody 22E11 9844
316 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
317 4NC2 2 B B39 VHH 9844
318 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
319 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
320 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
321 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
322 5F9A 2 C Nanobody Nb-ER19 9844
323 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
324 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
325 5CBA 1 A, C 3b4 heavy chain 9606
326 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
327 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
328 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
329 2OTW 2 B, D Fv heavy chain variable domain VH 10090
330 3STB 1 A, B single domain antibody VHH 9844
331 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
332 4W6W 2 B NbFedF6 9844
333 5JA8 2 B, D, F, H Nanobody 2 9844
334 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
335 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
336 2AP2 2 B, D PROTEIN (ANTIBODY (HEAVY CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
337 1P4B 2 H Antibody Variable heavy chain 10090
338 5O0W 2 E, F, G, H Nb474 30538
339 4Y5V 1 A, D, G diabody 305 VH domain 9606
340 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
341 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
342 3V0A 3 C Llama antibody F12 9844
343 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
344 3K80 1 A, B Antibody 9844
345 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
346 5F8Q 2 C, D Nanobody Nb-ER19 9844
347 4U05 1 A, B Single Domain Antibody 9844
348 5F9D 2 C Nanobody Nb-ER19 9844
349 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
350 4LGP 2 B, D VHH1 camelid nanobody 30538
351 2P48 2 B ANTIBODY CAB-RN05 9838
352 5VXK 1 B single-domain antibody JMK-H2 30538
353 5F7M 2 C, D Nanobody Nb-ER19 9844
354 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
355 5F7W 2 C, D Nanobody Nb-ER19 9844
356 4YQX 1 H, N JES6-1 VH domain 10116
357 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
358 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
359 1KTR 3 H Anti-his tag antibody 3d5 variable heavy chain 10090
360 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
361 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
362 4NC1 2 C, D A20.1 VHH 9844
363 4NC1 3 E, F A26.8 VHH 9844
364 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
365 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
366 2DQF 2 B, E Ig VH,anti-lysozyme 10090
367 5E7F 1 A, B, C nanobody L06 9838
368 2P46 2 B, D ANTIBODY CAB-RN05 9838
369 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
370 5LHP 2 B Camelid-Derived Antibody Fragment 30538
371 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
372 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
373 5SV4 1 A, B Single Domain Antibody A3C8 9844
374 4LGS 2 B Camelid nanobody (VHH4) 30538
375 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
376 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
377 5CBE 1 A, C E10 heavy chain 9606
378 2P47 2 B ANTIBODY CAB-RN05 9838
379 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
380 3WXW 2 H V region heavy chain 10090
381 3K3Q 1 A llama Aa1 VHH domain 9844
382 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
383 1AR1 3 C ANTIBODY FV FRAGMENT 10090
384 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
385 1BVK 2 B, E HULYS11 FV 9606
386 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
387 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
388 5HVF 2 B VHH-i83 30538
389 1P4I 2 H antibody variable heavy chain 10090
390 4PGJ 1 A, C Human heavy chain domain antibody 9606
391 4KDT 1 A, B Nanobody24 9835
392 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
393 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
394 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
395 5MJE 2 B Nanobody 8 9844
396 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
397 3OGO 2 E, F, G, H GFP-nanobody 9838
398 4C59 2 B NANOBODY 9844
399 5VXL 2 B single-domain antibody JPS-G3 30538
400 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
401 4DK6 1 A, B single domain antibody VHH 9844
402 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
403 5F7L 2 B, D Nanobody Nb-ER14 9844
404 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
405 5HVG 2 B, D VHH-a204 30538
406 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
407 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606 3.4.19.13 | Details
408 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
409 5HVH 2 B VHH-a204 30538
410 5HVH 3 C VHH-i83 30538
411 4XT1 3 C nanobody 7 30538
412 5LXG 2 H V REGION HEAVY CHAIN 10090
413 5HM1 1 A, B, C lama VHH antibody 2E7 9844
414 5FUC 3 E, V VHH6 9838
415 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
416 3H3P 1 H, I Fv 4E10 heavy chain 9606
417 5O2U 2 B, D VHH 59H10 9844
418 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
419 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
420 5OMN 2 C Nanobody (VHH) Nano-27 30538
421 4KRP 2 B Nanobody/VHH domain 9G8 9844
422 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
423 4FHB 2 D Nb179 9844
424 4DK3 1 A, B single domain antibody VHH 9844
425 4KRL 1 B Nanobody/VHH domain 7D12 9844
426 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
427 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
428 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
429 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
430 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
431 4LDE 2 B Camelid Antibody Fragment 9844
432 4Y5Y 1 A, D diabody 330 VH domain 9606
433 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
434 1BVL 1 A, C HULYS11 FV 10090
435 3RJQ 2 B Llama VHH A12 9844
436 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
437 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
438 3LHP 1 H, I Fv 4E10 heavy chain 9606
439 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
440 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
441 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
442 4KFZ 2 C, D Anti-LMO2 VH 9606 3.4.19.13 | Details
443 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
444 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
445 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
446 4YGA 2 B, D, F, H VHH-1B7 30538
447 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
448 2A9N 2 H, I fluorescein-scfv heavy chain 9606
449 5GS0 3 D, F heavy chain (anti-TLR3) 10090
450 5GS0 4 H, X heavy chain (anti-Lid) 10090
451 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
452 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
453 5GRJ 1 H avelumab H chain 9606
454 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
455 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
456 4KRO 2 B Nanobody/VHH domain EgA1 9844
457 3WXV 2 H V region heavy chain 10090
458 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
459 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
460 5TJW 2 K NP-specific inhibitory VHH 30538
461 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
462 4LDL 2 B Camelid Antibody Fragment 9844
463 4LDO 2 B Camelid Antibody Fragment 9844
464 3SN6 5 N Camelid antibody VHH fragment 9844
465 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
466 4M8Q 1 A, H GEP1 Fv heavy chain 9606
467 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
468 5C3L 4 D Nanobody Nb15 Nanobody 9838
469 5J3H 2 C mAb 83-7 Fab heavy chain 10090
470 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
471 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
472 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
473 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
474 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
475 4PIR 2 F, G, H, I, J VHH15 9844
476 4QKX 2 B R9 protein 9844
477 5JQH 2 C, D Nanobody60, Nb60 9844
478 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
479 4PD4 10 J Igh protein 10090
480 5DA0 2 B Nanobody 9844
481 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
482 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
483 4ODX 2 A, H GEP7 Fv heavy chain 9606
484 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
485 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
486 1RVF 6 H FAB 17-IA 10090
487 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
488 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
489 4MQS 2 B Nanobody 9-8 9844
490 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
491 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
492 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
493 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
494 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
495 4MQT 2 B Nanobody 9-8 9844
496 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
497 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
498 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
499 4NKO 2 B, D, F Engineered scFv heavy chain 10090
500 5EUL 4 V AYC08 30538
501 5GXB 2 B nanobody 30538
502 5NBD 2 C Nanobody 9844
503 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
504 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
505 5H8O 1 A VHH nanobody 9844
506 4KSD 2 B R2 protein 9844
507 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
508 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
509 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
510 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
511 5TD8 5 E nanobody 30538
512 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
513 5XS7 2 H Heavy chain of Fab 1D5 10090
514 5W3L 5 E C5 antibody variable heavy domain 10090
515 5W3M 1 E C5 antibody variable heavy domain 10090
516 5W3O 1 D C5 antibody variable heavy domain 10090
517 5W3E 1 E C5 antibody variable heavy domain 10090
518 5VAI 6 N nanobody 35 9844
519 5UZ7 4 N NANOBODY 35 9844
520 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
521 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
522 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
523 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
524 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
525 5H30 3 G, I, K IgG C10 heavy chain 9606
526 5KWL 4 7 VHH 10E 9838
527 5KTZ 4 7 VHH 12B 9838
528 5KU0 4 7 VHH 17B 9838
529 5KU2 4 7 VHH 7A 9838
530 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
531 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
532 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
533 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
534 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
535 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
536 3JCX 2 H Fab E heavy chain 10116
537 5FOJ 1 A NANOBODY 9838
538 3JBC 5 7 nanobody VHH PVSP29F 9838
539 3JBD 5 7 nanobody VHH PVSP6A 9838
540 3JBE 5 7 nanobody VHH PVSS8A 9838
541 3JBF 5 7 nanobody VHH PVSP19B 9838
542 3JBG 5 7 nanobody VHH PVSS21E 9838
543 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
544 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
545 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
546 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
547 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
548 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
549 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
550 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
551 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
552 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
553 3J6U 3 H Fab 5J7 heavy chain variable region 9606
554 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
555 3IY1 2 B Fab B, heavy chain 10116
556 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
557 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
558 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
559 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
560 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
561 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
562 3IY0 2 H Fab 14, heavy domain 10090
563 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
564 1G9E 1 A H14 9844
565 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
566 1VHP 1 A VH-P8 9606