Sequence Similarity Clusters for the Entities in PDB 1KXV

Entity #1 | Chains: A,B
ALPHA-AMYLASE, PANCREATIC protein, length: 496 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 6979
95 % 3 17 2652 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.6
PDBFlex
90 % 3 17 2702
70 % 17 78 581
50 % 18 82 596
40 % 18 91 565
30 % 18 91 562
Entity #2 | Chains: C,D
CAMELID VHH DOMAIN CAB10 protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 46141
95 % 1 1 34547
90 % 1 1 33002
70 % 1 1 29364
50 % 75 580 7
40 % 106 933 5
30 % 117 1061 7

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 5IVN 1 A BC2-nanobody 30538
2 5E7B 1 A nanobody nano-L06 9838
3 2P45 2 B ANTIBODY CAB-RN05 9838
4 2X1Q 1 A, B GELSOLIN NANOBODY 9844
5 5U64 1 B VHH-28 9838
6 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
7 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
8 4B41 1 A, B ANTIBODY G7 9844
9 5IMM 1 B Nanobody 9835
10 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
11 5NLU 1 A single domain llama antibody Nb36 9844
12 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
13 5IMK 1 B Nanobody 9835
14 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
15 4B50 1 A 2H10 LLAMA VHH 9844
16 2XT1 2 B CAMELID VHH 9 30538
17 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
18 5J1S 3 C VHH domain BS-2 30538
19 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
20 5J1T 3 C VHH domain BS-2 30538
21 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
22 2X1O 1 A, B GELSOLIN NANOBODY 9844
23 4QGY 1 A, B nanobody n25, VH domain 9844
24 5C2B 1 H scFv 3B4 heavy chain 9606
25 5DXW 1 A PD-L1 nanobody 10090
26 4N9O 2 B Nanobody Nb484 Nb484 9844
27 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
28 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
29 1T2J 1 A M12-Variable Heavy domain 9606
30 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
31 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
32 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
33 4KML 2 B Nanobody 9844
34 4Z9K 2 B VHH2(F5) antibody 30538
35 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
36 5LMW 1 A Nanobody 9844
37 5NM0 1 A, B, C, D Nb36 9844
38 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
39 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
40 4PPT 1 A Engineered single domain VHH antibody 9844
41 3R0M 1 A, B Llama VHH A12 9844
42 3ZKQ 2 D XA4813 9844
43 4I13 2 B Protein ca1697 (nanobody) 9844
44 5C2U 1 B Nanobody Nanobody 9838
45 1XFP 1 A heavy chain antibody VHH domain 9838
46 4POY 1 A VHH-metal 9844
47 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
48 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
49 5NLW 1 A nanobody Nb36 9844
50 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
51 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
52 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
53 3G9A 2 B Minimizer 9838
54 2P43 2 B ANTIBODY CAB-RN05 9838
55 4KRN 1 A Nanobody/VHH domain EgA1 9844
56 4GFT 2 B Nanobody 9844
57 4TVS 2 a, b VHH Domain BS-1 30538
58 4W6Y 2 B Nanobody NbFedF9 9844
59 6EZW 1 B VHH antibody BCD090-M2 9844
60 1UAC 2 H Ig VH,anti-lysozyme 10090
61 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
62 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
63 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
64 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
65 5O02 2 C Nanobody (VHH) Nano-4 30538
66 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
67 4X7F 2 C, D Nano-25 Nanobody 30538
68 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
69 4LGR 2 B Camelid nanobody (VHH3) 30538
70 5J57 2 B VHH single chain antibody V5E1 30538
71 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
72 5OMM 2 C Nanobody (VHH) Nano-14 30538
73 5E03 1 A mouse CTLA-4 nanobody 10090
74 5LZ0 1 A, B PorM nanobody 9844
75 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
76 2XXC 1 B CAMELID VHH 9 30538
77 3QYC 1 A, B VH domain of IgG molecule 9606
78 2XXM 2 B CAMELID VHH 9 30538
79 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
80 5JDS 1 B Nanobody 9835
81 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
82 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
83 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
84 5L21 2 B VHH-C2 30538
85 5FWO 1 A NANOBODY 9844
86 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
87 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
88 3B9V 1 A, B, C, D heavy chain variable domain 9606
89 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
90 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
91 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
92 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
93 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
94 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
95 4POU 2 B VHH Antibody 9844
96 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
97 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
98 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
99 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
100 2P42 2 B, D ANTIBODY CAB-RN05 9838
101 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
102 4QLR 1 A, B Llama nanobody n02 VH domain 9844
103 5J56 2 B VHH single chain antibody V1C7 30538
104 4NBX 2 B A20.1 VHH 9844
105 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
106 4HEP 2 G vHH17 domain 9844
107 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
108 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
109 5IML 2 B Nanobody 9835
110 3A6C 2 H IG VH, anti-lysozyme 10090
111 2DQD 2 H Ig VH,anti-lysozyme 10090
112 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
113 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
114 3A67 2 H IG VH, anti-lysozyme 10090
115 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
116 1J1X 2 H Ig VH,anti-lysozyme 10090
117 5M2J 2 D Anti-(ED-B) scFV 9606
118 2DQC 2 H Ig VH,anti-lysozyme 10090
119 1J1O 2 H Ig VH,anti-lysozyme 10090
120 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
121 4M62 2 H, I GEP2 FV heavy chain 9606
122 5IVO 1 A BC2-nanobody 30538
123 1J1P 2 H Ig VH,anti-lysozyme 10090
124 4NBZ 2 B, D A26.8 VHH 9844
125 5AYU 2 H Ig VH,anti-lysozyme 10090
126 3A6B 2 H IG VH, anti-lysozyme 10090
127 2DQJ 2 H Ig VH,anti-lysozyme 10090
128 5F21 2 B nanobody MU375 9844
129 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
130 2P44 2 B ANTIBODY CAB-RN05 9838
131 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
132 5TP3 1 A, B F-VHH-4 9844
133 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
134 4LHJ 2 B Camelid antibody 30538
135 4BEL 2 D, E XA4813 9844
136 5M7Q 1 A, B Nanobody NbD2 9838
137 5H8D 1 A VHH nanobody 9844
138 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
139 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
140 3DUR 2 B, D Ig-like protein 10090
141 2XV6 2 B, D CAMELID VHH 9 30538
142 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
143 4ZG1 1 A, B, C, D, E, F NB17 9844
144 4I1N 2 B Protein ca1697 (nanobody) 9844
145 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
146 6F0D 1 A, B VHH antibody BCD090-M2 9844
147 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
148 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
149 4W6X 2 B Nanobody NbFedF7 9844
150 5JA9 2 A, B Nanobody 6 9844
151 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
152 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
153 1OP9 1 A HL6 camel VHH fragment 9838
154 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
155 4LRN 1 H GEP 1 heavy chain 9606
156 4S11 1 A GELSOLIN NANOBODY 9844
157 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
158 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
159 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
160 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
161 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
162 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
163 4Y7M 1 A, B Hi113 protein 9844
164 5JMO 2 C, D camelid VHH fragment 9838
165 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
166 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
167 4B5E 1 A, B PS2-8 9844
168 2DQE 2 H Ig VH,anti-lysozyme 10090
169 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
170 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
171 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
172 4X7C 2 C, D Nano-85 Nanobody VHH 30538
173 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
174 3EBA 1 A CAbHul6 9838
175 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606 3.4.19.13 | Details
176 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
177 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
178 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
179 4I0C 2 C, D cAbHuL5 antibody 9838
180 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
181 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
182 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
183 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
184 5BOP 1 A, C Nanobody 9844
185 4DKA 1 A, B single domain antibody VHH 9844
186 5O05 1 C, D Nanobody (VHH) Nano-42 30538
187 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606 3.4.19.13 | Details
188 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
189 3DUU 2 B, D Ig-like protein 10090
190 3K74 2 B Nanobody 9844
191 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
192 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
193 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
194 1SJV 1 A r9 llama VHH single domain antibody 9844
195 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
196 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
197 1UA6 2 H Ig VH,anti-lysozyme 10090
198 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
199 4W68 1 A, B Single domain antibody 9844
200 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
201 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
202 3EAK 1 A, B NbBCII10-FGLA 9838
203 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
204 4ORZ 3 C single domain antibody sdAb19 9844
205 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
206 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
207 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
208 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
209 5C1M 2 B Nanobody 39 9844
210 5F7K 2 C, D Nanobody Nb-ER19 9844
211 5LMJ 1 A, B, C, D nanobody 9844
212 5E1H 2 B F8(JOB10) VHH antibody 30538
213 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
214 4OCM 3 C, F Nb1 9844
215 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
216 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
217 4X7E 2 C, D Nano-85 Nanobody 30538
218 5F1O 2 B nanobody MU551 9844
219 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
220 5O03 2 C, D Nanobody (VHH) Nano-32 11983
221 2DQI 2 H Ig VH,anti-lysozyme 10090
222 4Y8D 2 C, D nanobody 9844
223 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
224 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
225 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
226 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
227 4C58 2 B NANOBODY 9844
228 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
229 3DV6 2 B Ig-like protein 10090
230 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
231 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
232 5VXM 2 B Single-domain antibody 20ipaD 30538
233 4XVJ 2 H antibody heavy chain variable domain 9606
234 4IDL 1 A Single Domain Antibody VHH A9 9844
235 1JV5 2 B Ig chain heavy chain precursor V region 9606
236 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
237 3K7U 1 A Antibody 9844
238 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
239 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
240 4NBY 2 B, C A20.1 VHH 9844
241 4X7D 2 C, D Nano-85 Nanobody VHH 9844
242 5F7N 2 C, D Nanobody Nb-ER19 30538
243 5OCL 1 A, C, F, H anti-llama nanobody 30538
244 5OCL 2 B, D, E, G anti-vglut nanobody 9844
245 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
246 2A9M 2 H, I fluorescein-scfv heavy chain 9606
247 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
248 1SJX 1 A immunoglobulin VH domain 9844
249 3ZKS 2 D XA4813 9844
250 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
251 5MY6 2 B Nanobody 2Rs15d 9838
252 3DUS 2 B, D Ig-like protein 10090
253 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
254 5M2I 2 G, H, I, J, K, L VHH1 9844
255 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
256 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
257 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
258 3K1K 2 C, D Enhancer 9838
259 4U7S 1 A, B sdAb A3 9844
260 4U3X 1 A, C Human VH domain antibody 9606
261 4W81 1 A Single Domain Antibody 9844
262 5GRV 1 L homo-specific diabody heavy chain 9606
263 5JMR 1 A, B camelid VHH fragment 9838
264 4W70 1 A Single Domain Antibody 9844
265 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
266 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
267 4BFB 2 D, E XA4813 9844
268 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
269 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
270 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
271 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
272 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
273 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
274 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
275 4LHQ 2 B, D Camelid nanobody 30538
276 3DV4 2 B Ig-like protein 10090
277 3ZKX 2 B XA4813 9844
278 3ZKX 3 C XA4815 9844
279 5F1K 2 C, D nanobody MU1053 9844
280 3ZLQ 2 C, D XA4813 9844
281 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
282 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
283 4NC0 2 B A26.8 VHH 9844
284 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
285 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
286 5GS1 2 B, N, P, R heavy chain 9606
287 5F7Y 3 C, D Nanobody Nb-ER19 9844
288 2DQG 2 H Ig VH,anti-lysozyme 10090
289 5IMO 1 B Nanobody 9835
290 5U65 1 A, B VHH-5 9838
291 4TYU 1 A, B Single Domain Antibody 9844
292 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
293 2DQH 2 H Ig VH,anti-lysozyme 10090
294 4AQ1 2 B, D NBKB6 VHH 9844
295 4EIG 2 B CA1698 camel antibody fragment 9844
296 3EHB 3 C FV fragment Chain H 10090
297 3HB3 3 C ANTIBODY FV FRAGMENT 10090
298 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
299 2X89 1 A, B, C ANTIBODY 9838
300 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
301 5O04 2 E, F Nanobody (VHH) Nano-26 30538
302 5O04 3 C, D Nanobody (VHH) Nano-85 30538
303 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
304 3P9W 2 B, D, F, H human VEGF 9606
305 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
306 5F8R 2 C, D Nanobody Nb-ER19 9844
307 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
308 4OCL 3 C, F Nb1 9844
309 4RAV 2 A, C single-chain Fv, VH 9606
310 5LWY 2 H V REGION HEAVY CHAIN 10090
311 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
312 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
313 4IOS 2 D, E, F, G Llama nanobody 11 9844
314 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
315 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
316 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
317 4C57 2 C, D NANOBODY 9844
318 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
319 4OCN 3 C, F Nb1 9844
320 4GRW 3 E, G Nanobody 124C4 9844
321 4GRW 4 F, J Nanobody 37D5 9844
322 4GRW 5 H, I Nanobody 22E11 9844
323 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
324 4NC2 2 B B39 VHH 9844
325 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
326 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
327 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
328 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
329 5F9A 2 C Nanobody Nb-ER19 9844
330 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
331 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
332 5CBA 1 A, C 3b4 heavy chain 9606
333 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
334 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
335 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
336 2OTW 2 B, D Fv heavy chain variable domain VH 10090
337 3STB 1 A, B single domain antibody VHH 9844
338 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
339 4W6W 2 B NbFedF6 9844
340 5JA8 2 B, D, F, H Nanobody 2 9844
341 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
342 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
343 2AP2 2 B, D PROTEIN (ANTIBODY (HEAVY CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
344 1P4B 2 H Antibody Variable heavy chain 10090
345 5U4M 2 B V1C7 VHH antibody 30538
346 5O0W 2 E, F, G, H Nb474 30538
347 4Y5V 1 A, D, G diabody 305 VH domain 9606
348 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
349 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
350 3V0A 3 C Llama antibody F12 9844
351 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
352 3K80 1 A, B Antibody 9844
353 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
354 5F8Q 2 C, D Nanobody Nb-ER19 9844
355 4U05 1 A, B Single Domain Antibody 9844
356 5F9D 2 C Nanobody Nb-ER19 9844
357 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
358 4LGP 2 B, D VHH1 camelid nanobody 30538
359 2P48 2 B ANTIBODY CAB-RN05 9838
360 5U4L 2 B V1C7 VHH antibody G29R variant 30538
361 5VXK 1 B single-domain antibody JMK-H2 30538
362 5F7M 2 C, D Nanobody Nb-ER19 9844
363 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
364 5F7W 2 C, D Nanobody Nb-ER19 9844
365 4YQX 1 H, N JES6-1 VH domain 10116
366 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
367 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
368 1KTR 3 H Anti-his tag antibody 3d5 variable heavy chain 10090
369 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
370 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
371 4NC1 2 C, D A20.1 VHH 9844
372 4NC1 3 E, F A26.8 VHH 9844
373 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
374 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
375 2DQF 2 B, E Ig VH,anti-lysozyme 10090
376 5E7F 1 A, B, C nanobody L06 9838
377 2P46 2 B, D ANTIBODY CAB-RN05 9838
378 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
379 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
380 5LHP 2 B Camelid-Derived Antibody Fragment 30538
381 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
382 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
383 5SV4 1 A, B Single Domain Antibody A3C8 9844
384 4LGS 2 B Camelid nanobody (VHH4) 30538
385 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
386 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
387 5CBE 1 A, C E10 heavy chain 9606
388 2P47 2 B ANTIBODY CAB-RN05 9838
389 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
390 3WXW 2 H V region heavy chain 10090
391 3K3Q 1 A llama Aa1 VHH domain 9844
392 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
393 1AR1 3 C ANTIBODY FV FRAGMENT 10090
394 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
395 1BVK 2 B, E HULYS11 FV 9606
396 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
397 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
398 5HVF 2 B VHH-i83 30538
399 1P4I 2 H antibody variable heavy chain 10090
400 4PGJ 1 A, C Human heavy chain domain antibody 9606
401 4KDT 1 A, B Nanobody24 9835
402 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
403 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
404 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
405 5MJE 2 B Nanobody 8 9844
406 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
407 3OGO 2 E, F, G, H GFP-nanobody 9838
408 4C59 2 B NANOBODY 9844
409 5VXL 2 B single-domain antibody JPS-G3 30538
410 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
411 4DK6 1 A, B single domain antibody VHH 9844
412 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
413 5F7L 2 B, D Nanobody Nb-ER14 9844
414 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
415 5HVG 2 B, D VHH-a204 30538
416 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
417 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606 3.4.19.13 | Details
418 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
419 5HVH 2 B VHH-a204 30538
420 5HVH 3 C VHH-i83 30538
421 4XT1 3 C nanobody 7 30538
422 5LXG 2 H V REGION HEAVY CHAIN 10090
423 5HM1 1 A, B, C lama VHH antibody 2E7 9844
424 5FUC 3 E, V VHH6 9838
425 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
426 3H3P 1 H, I Fv 4E10 heavy chain 9606
427 5O2U 2 B, D VHH 59H10 9844
428 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
429 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
430 5OMN 2 C Nanobody (VHH) Nano-27 30538
431 4KRP 2 B Nanobody/VHH domain 9G8 9844
432 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
433 4FHB 2 D Nb179 9844
434 4DK3 1 A, B single domain antibody VHH 9844
435 4KRL 1 B Nanobody/VHH domain 7D12 9844
436 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
437 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
438 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
439 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
440 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
441 4LDE 2 B Camelid Antibody Fragment 9844
442 4Y5Y 1 A, D diabody 330 VH domain 9606
443 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
444 1BVL 1 A, C HULYS11 FV 10090
445 3RJQ 2 B Llama VHH A12 9844
446 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
447 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
448 3LHP 1 H, I Fv 4E10 heavy chain 9606
449 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
450 6EQI 2 B Nb696 9844
451 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
452 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
453 4KFZ 2 C, D Anti-LMO2 VH 9606 3.4.19.13 | Details
454 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
455 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
456 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
457 4YGA 2 B, D, F, H VHH-1B7 30538
458 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
459 2A9N 2 H, I fluorescein-scfv heavy chain 9606
460 5GS0 3 D, F heavy chain (anti-TLR3) 10090
461 5GS0 4 H, X heavy chain (anti-Lid) 10090
462 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
463 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
464 5GRJ 1 H avelumab H chain 9606
465 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
466 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
467 4KRO 2 B Nanobody/VHH domain EgA1 9844
468 3WXV 2 H V region heavy chain 10090
469 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
470 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
471 5TJW 2 K NP-specific inhibitory VHH 30538
472 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
473 4LDL 2 B Camelid Antibody Fragment 9844
474 4LDO 2 B Camelid Antibody Fragment 9844
475 3SN6 5 N Camelid antibody VHH fragment 9844
476 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
477 4M8Q 1 A, H GEP1 Fv heavy chain 9606
478 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
479 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
480 5O8F 2 K, O Nanobody Nb25 9844
481 5O8F 3 L, M, N Nanobody Nb25 9844
482 5C3L 4 D Nanobody Nb15 Nanobody 9838
483 5J3H 2 C mAb 83-7 Fab heavy chain 10090
484 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
485 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
486 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
487 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
488 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
489 4PIR 2 F, G, H, I, J VHH15 9844
490 4QKX 2 B R9 protein 9844
491 5JQH 2 C, D Nanobody60, Nb60 9844
492 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
493 4PD4 10 J Igh protein 10090
494 5DA0 2 B Nanobody 9844
495 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
496 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
497 4ODX 2 A, H GEP7 Fv heavy chain 9606
498 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
499 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
500 1RVF 6 H FAB 17-IA 10090
501 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
502 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
503 4MQS 2 B Nanobody 9-8 9844
504 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
505 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
506 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
507 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
508 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
509 4MQT 2 B Nanobody 9-8 9844
510 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
511 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
512 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
513 4NKO 2 B, D, F Engineered scFv heavy chain 10090
514 5EUL 4 V AYC08 30538
515 5GXB 2 B nanobody 30538
516 5NBD 2 C Nanobody 9844
517 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
518 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
519 5H8O 1 A VHH nanobody 9844
520 4KSD 2 B R2 protein 9844
521 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
522 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
523 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
524 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
525 5TD8 5 E nanobody 30538
526 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
527 5XS7 2 H Heavy chain of Fab 1D5 10090
528 5W3L 5 E C5 antibody variable heavy domain 10090
529 5W3M 1 E C5 antibody variable heavy domain 10090
530 5W3O 1 D C5 antibody variable heavy domain 10090
531 5W3E 1 E C5 antibody variable heavy domain 10090
532 5VAI 6 N nanobody 35 9844
533 5UZ7 4 N NANOBODY 35 9844
534 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
535 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
536 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
537 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
538 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
539 5H30 3 G, I, K IgG C10 heavy chain 9606
540 5KWL 4 7 VHH 10E 9838
541 5KTZ 4 7 VHH 12B 9838
542 5KU0 4 7 VHH 17B 9838
543 5KU2 4 7 VHH 7A 9838
544 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
545 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
546 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
547 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
548 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
549 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
550 3JCX 2 H Fab E heavy chain 10116
551 5FOJ 1 A NANOBODY 9838
552 3JBC 5 7 nanobody VHH PVSP29F 9838
553 3JBD 5 7 nanobody VHH PVSP6A 9838
554 3JBE 5 7 nanobody VHH PVSS8A 9838
555 3JBF 5 7 nanobody VHH PVSP19B 9838
556 3JBG 5 7 nanobody VHH PVSS21E 9838
557 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
558 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
559 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
560 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
561 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
562 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
563 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
564 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
565 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
566 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
567 3J6U 3 H Fab 5J7 heavy chain variable region 9606
568 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
569 3IY1 2 B Fab B, heavy chain 10116
570 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
571 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
572 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
573 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
574 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
575 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
576 3IY0 2 H Fab 14, heavy domain 10090
577 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
578 1G9E 1 A H14 9844
579 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
580 1VHP 1 A VH-P8 9606