Sequence Similarity Clusters for the Entities in PDB 1KXV

Entity #1 | Chains: A,B
ALPHA-AMYLASE, PANCREATIC protein, length: 496 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 6972
95 % 3 17 2651 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.6
PDBFlex
90 % 3 17 2699
70 % 17 78 577
50 % 18 82 591
40 % 18 91 564
30 % 18 91 561
Entity #2 | Chains: C,D
CAMELID VHH DOMAIN CAB10 protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 46076
95 % 1 1 34495
90 % 1 1 32962
70 % 1 1 29334
50 % 75 578 7
40 % 106 931 5
30 % 117 1059 7

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4UNU 1 A, B IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
2 5IVN 1 A BC2-nanobody 30538
3 5ACM 1 A, B MCG IG LAMBDA CHAIN V-II REGION MGC 9606
4 5E7B 1 A nanobody nano-L06 9838
5 2P45 2 B ANTIBODY CAB-RN05 9838
6 2X1Q 1 A, B GELSOLIN NANOBODY 9844
7 5U64 1 B VHH-28 9838
8 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
9 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
10 4B41 1 A, B ANTIBODY G7 9844
11 5IMM 1 B Nanobody 9835
12 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
13 4QYO 2 B Fv fragment(mAb6D8) light chain 10090
14 5NLU 1 A single domain llama antibody Nb36 9844
15 2Q20 1 A, B Vk1 O18/O8 germline light chain variable domain 9606
16 1MQK 1 L antibody 7E2 FV fragment, light chain 10090
17 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
18 5IMK 1 B Nanobody 9835
19 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
20 4B50 1 A 2H10 LLAMA VHH 9844
21 2XT1 2 B CAMELID VHH 9 30538
22 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
23 4QY8 2 B Fv fragment(mAb6D8) light chain 10090
24 5J1S 3 C VHH domain BS-2 30538
25 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
26 2I24 1 N New Antigen Receptor PBLA8 variable domain 7801
27 5L6Q 1 A, B H5AL 9606
28 5J1T 3 C VHH domain BS-2 30538
29 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
30 2X1O 1 A, B GELSOLIN NANOBODY 9844
31 4QGY 1 A, B nanobody n25, VH domain 9844
32 5C2B 1 H scFv 3B4 heavy chain 9606
33 5C2B 2 L 3B4 light chain 9606
34 5DXW 1 A PD-L1 nanobody 10090
35 3T0W 1 A, B immunoglobulin variable lambda domain 9606
36 4N9O 2 B Nanobody Nb484 Nb484 9844
37 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
38 5ACL 1 A MCG IG LAMBDA CHAIN V-II REGION MGC 9606
39 3T0V 1 A immunoglobulin variable lambda domain 9606
40 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
41 1OAQ 2 L LIGHT CHAIN FV, RESIDUES 1-120 10090
42 1T2J 1 A M12-Variable Heavy domain 9606
43 1DLF 1 L ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
44 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
45 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
46 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
47 1SQ2 2 N novel antigen receptor 7801
48 4KML 2 B Nanobody 9844
49 4Z9K 2 B VHH2(F5) antibody 30538
50 1J05 1 A, L anti-CEA mAb T84.66, light chain Fv fragment 10090
51 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
52 5LMW 1 A Nanobody 9844
53 5NM0 1 A, B, C, D Nb36 9844
54 2RHE 1 A BENCE-JONES PROTEIN RHE (LIGHT CHAIN) 9606
55 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
56 4QXT 2 B Fv fragment(mAb6D8) light chain 10090
57 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
58 4PPT 1 A Engineered single domain VHH antibody 9844
59 3R0M 1 A, B Llama VHH A12 9844
60 3ZKQ 2 D XA4813 9844
61 4I13 2 B Protein ca1697 (nanobody) 9844
62 5C2U 1 B Nanobody Nanobody 9838
63 1XFP 1 A heavy chain antibody VHH domain 9838
64 4POY 1 A VHH-metal 9844
65 1A2Y 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
66 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
67 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
68 5NLW 1 A nanobody Nb36 9844
69 3CDC 1 A, B Light Chain Amyloidogenic 9606
70 3CDF 1 A, B, C, D, E, F IMMUNOGLOBULIN LIGHT CHAIN 9606
71 3DVI 1 A Amyloidogenic light chain variable domain AL-103 9606
72 2DLF 1 L PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN)) FV FRAGMENT (VL DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
73 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
74 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
75 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
76 3G9A 2 B Minimizer 9838
77 1EEQ 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
78 3U79 1 A, B, C, D, E, F, G, H Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain 9606
79 2P43 2 B ANTIBODY CAB-RN05 9838
80 4KRN 1 A Nanobody/VHH domain EgA1 9844
81 4GFT 2 B Nanobody 9844
82 4TVS 2 a, b VHH Domain BS-1 30538
83 4W6Y 2 B Nanobody NbFedF9 9844
84 6EZW 1 B VHH antibody BCD090-M2 9844
85 1UAC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
86 1UAC 2 H Ig VH,anti-lysozyme 10090
87 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
88 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
89 4R3S 2 B FV FRAGMENT(MAB6D8) LIGHT CHAIN 10090
90 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
91 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
92 1EEU 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
93 5O02 2 C Nanobody (VHH) Nano-4 30538
94 4UNV 1 A IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
95 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
96 4X7F 2 C, D Nano-25 Nanobody 30538
97 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
98 4UT7 2 L BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV LIGHT CHAIN DOMAIN, RESIDUES 1-147 9606
99 4LGR 2 B Camelid nanobody (VHH3) 30538
100 5J57 2 B VHH single chain antibody V5E1 30538
101 1MFA 1 L IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN) 10090
102 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
103 5OMM 2 C Nanobody (VHH) Nano-14 30538
104 5E03 1 A mouse CTLA-4 nanobody 10090
105 5LZ0 1 A, B PorM nanobody 9844
106 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
107 2XXC 1 B CAMELID VHH 9 30538
108 3QYC 1 A, B VH domain of IgG molecule 9606
109 2XXM 2 B CAMELID VHH 9 30538
110 5IR3 1 A Ig lambda chain V-VI region AR 9606
111 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
112 4AJ0 1 A, B, C, D GERMINAL LINE LAMBDA 3 3RCW VARIANT VARIABLE DOMAIN VARIANT OF 3RJL2, RESIDUES 1-107 9606
113 5JDS 1 B Nanobody 9835
114 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
115 4OB5 2 L 4E10 antibody germline precursor 7 light chain Fv 9606
116 1BWW 1 A, B PROTEIN (IG KAPPA CHAIN V-I REGION REI) IMMUNOGLOBULIN KAPPA LIGHT CHAIN 9606
117 5L8L 2 B New antigen receptor variable domain 168098
118 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
119 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
120 4AIZ 1 A, C, D V2-17 PROTEIN 9606
121 4AIZ 2 B V2-17 PROTEIN 9606
122 5L21 2 B VHH-C2 30538
123 5FWO 1 A NANOBODY 9844
124 5KVE 2 L ZV-48 Antibody scFv Light Chain 10090
125 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
126 4L1H 1 A Ig kappa chain V-I region Rei 9606
127 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
128 3B9V 1 A, B, C, D heavy chain variable domain 9606
129 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
130 1VFA 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
131 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
132 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
133 2D7T 2 L anti polyhydroxybutyrate antibody Fv, light chain residues 1-110 9606
134 3BD3 1 A, B catalytic antibody 10090
135 2OTU 1 A, C, E, G Fv light chain variable domain 10090
136 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
137 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
138 1EFQ 1 A KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
139 5L8J 2 B New antigen receptor variable domain 168098
140 1T6V 2 N, O novel antigen receptor 7801
141 2E27 1 L anti-ciguatoxin antibody, light chain Fv fragment 10090
142 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
143 4N1C 1 A, B immunoglobulin variable light chain domain 9606
144 4POU 2 B VHH Antibody 9844
145 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
146 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
147 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
148 4AIX 1 A, B, C, D IG LAMBDA CHAIN V-IV REGION BAU 9606
149 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
150 2P42 2 B, D ANTIBODY CAB-RN05 9838
151 1I8K 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
152 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
153 4QLR 1 A, B Llama nanobody n02 VH domain 9844
154 5J56 2 B VHH single chain antibody V1C7 30538
155 4X4Z 1 A, B Herceptin VL domain with F53D mutation 9606
156 4NBX 2 B A20.1 VHH 9844
157 1G7J 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
158 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
159 4HEP 2 G vHH17 domain 9844
160 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
161 1PEW 1 A, B Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN 9606
162 1VFB 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
163 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
164 5IML 2 B Nanobody 9835
165 3A6C 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
166 3A6C 2 H IG VH, anti-lysozyme 10090
167 2DQD 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
168 2DQD 2 H Ig VH,anti-lysozyme 10090
169 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
170 1WTL 1 A, B BENCE-JONES PROTEIN MCG (LIGHT CHAIN) 9606
171 2I25 1 N, O New Antigen Receptor PBLA8 variable domain 7801
172 1G7I 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
173 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
174 3A67 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
175 3A67 2 H IG VH, anti-lysozyme 10090
176 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
177 1J1X 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
178 1J1X 2 H Ig VH,anti-lysozyme 10090
179 5L8K 2 B New antigen receptor variable domain 168098
180 5M2J 2 D Anti-(ED-B) scFV 9606
181 2DQC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
182 2DQC 2 H Ig VH,anti-lysozyme 10090
183 1J1O 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
184 1J1O 2 H Ig VH,anti-lysozyme 10090
185 1MVU 1 A Ig kappa-chain VJ-region (Light chain) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
186 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
187 4M62 1 L, M GEP2 FV light chain UNP residues 21-129 9606
188 4M62 2 H, I GEP2 FV heavy chain 9606
189 5IVO 1 A BC2-nanobody 30538
190 1J1P 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
191 1J1P 2 H Ig VH,anti-lysozyme 10090
192 4NBZ 2 B, D A26.8 VHH 9844
193 1QAC 1 A, B IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN VARIABLE DOMAIN 9606
194 5AYU 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
195 5AYU 2 H Ig VH,anti-lysozyme 10090
196 3A6B 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
197 3A6B 2 H IG VH, anti-lysozyme 10090
198 2DQJ 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
199 2DQJ 2 H Ig VH,anti-lysozyme 10090
200 5F21 2 B nanobody MU375 9844
201 1N4X 1 L, M immunoglobulin kappa chain variable region 10090
202 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
203 2P44 2 B ANTIBODY CAB-RN05 9838
204 3DVF 1 A Amyloidogenic immunoglobulin light chain protein AL-12 9606
205 1KIQ 1 A MONOCLONAL ANTIBODY D1.3 10090
206 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
207 5TP3 1 A, B F-VHH-4 9844
208 2IMN 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
209 3B5G 1 A, B AMYLOID LAMBDA 6 LIGHT CHAIN VARIABLE REGION PIP residues 1-111 9606
210 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
211 4LHJ 2 B Camelid antibody 30538
212 4BEL 2 D, E XA4813 9844
213 5M7Q 1 A, B Nanobody NbD2 9838
214 5H8D 1 A VHH nanobody 9844
215 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
216 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
217 3DUR 1 A, C antibody Fv fragment SAG173-04 variable region fragment (Fv) 10090
218 3DUR 2 B, D Ig-like protein 10090
219 5T93 1 A, B, C, D ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient last residue was not visible on electron density 9606
220 2XV6 2 B, D CAMELID VHH 9 30538
221 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
222 1LVE 1 A LEN, A VARIABLE DOMAIN FROM KAPPA-4 TYPE 9606
223 4ZG1 1 A, B, C, D, E, F NB17 9844
224 2IMM 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
225 4I1N 2 B Protein ca1697 (nanobody) 9844
226 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
227 5C9K 1 A, B, C, D, E, F, G, H Amyloid lambda 6 light chain variable region PIP 9606
228 6F0D 1 A, B VHH antibody BCD090-M2 9844
229 1FGV 1 L H52 FV (LIGHT CHAIN) 9606
230 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
231 4LCI 1 L anti canine CD28 antibody, 1C6, light chain 10090
232 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
233 4W6X 2 B Nanobody NbFedF7 9844
234 5JA9 2 A, B Nanobody 6 9844
235 1A7N 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
236 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
237 1CD0 1 A, B PROTEIN (JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) IMMUNOGLOBULIN VARIABLE DOMAIN 9606
238 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
239 1OP9 1 A HL6 camel VHH fragment 9838
240 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
241 4LRN 1 H GEP 1 heavy chain 9606
242 4LRN 2 L GEP 1 light chain 9606
243 4S11 1 A GELSOLIN NANOBODY 9844
244 1EK3 1 A, B KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL, REC 9606
245 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
246 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
247 2YC1 2 B, E SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN 9606
248 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
249 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
250 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
251 1G7H 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
252 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
253 4Y7M 1 A, B Hi113 protein 9844
254 5JMO 2 C, D camelid VHH fragment 9838
255 1A7O 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
256 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
257 1KIR 1 A MONOCLONAL ANTIBODY D1.3 10090
258 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
259 4B5E 1 A, B PS2-8 9844
260 2DQE 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
261 2DQE 2 H Ig VH,anti-lysozyme 10090
262 1DVF 1 A FV D1.3 IGG1, KAPPA 10090
263 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
264 1DVF 3 C FV E5.2 IGG1, KAPPA 10090
265 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
266 1G7M 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
267 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
268 4X7C 2 C, D Nano-85 Nanobody VHH 30538
269 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
270 1OAU 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
271 1B0W 1 A, B, C BENCE-JONES KAPPA I PROTEIN BRE VARIABLE DOMAIN OF LIGHT CHAIN 9606
272 3EBA 1 A CAbHul6 9838
273 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606 3.4.19.13 | Details
274 1A6W 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
275 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
276 1A7R 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
277 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
278 1WZ1 1 L Ig light chain 10090
279 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
280 3UPA 1 A, B kappa light chain variable domain 9606
281 4I0C 2 C, D cAbHuL5 antibody 9838
282 3LVE 1 A LEN KAPPA-IV LIGHT CHAIN DIMER 9606
283 1A7P 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
284 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
285 4K3G 1 A, B immunoglobulin lambda variable domain L5(L89S) 9606
286 1XIW 3 C, G immunoglobulin light chain variable region 10090
287 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
288 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
289 5NGV 3 L anti-human ActRIIB mAb BYM338 light-chain VL 9606
290 1A7Q 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
291 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
292 5BOP 1 A, C Nanobody 9844
293 4DKA 1 A, B single domain antibody VHH 9844
294 5O05 1 C, D Nanobody (VHH) Nano-42 30538
295 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606 3.4.19.13 | Details
296 1DSF 1 L ANTICANCER ANTIBODY B1 FV 10090
297 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
298 3DUU 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
299 3DUU 2 B, D Ig-like protein 10090
300 3BJ9 1 1 Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1 Fusion protein consists of Ig domain of VPREB protein and J-fragment of Ig lambda-5 9606
301 1H5B 1 A MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
302 1H5B 2 B, D MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
303 1H5B 3 C MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
304 3LRG 1 A, B anti-huntingtin VL domain anti-huntingtin VL domain 9606
305 3K74 2 B Nanobody 9844
306 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
307 1KIP 1 A MONOCLONAL ANTIBODY D1.3 10090
308 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
309 5LVE 1 A BENCE-JONES PROTEIN LEN G KAPPA CHAIN V-IV, VARIABLE DOMAIN, LIGHT CHAIN 9606
310 2EIZ 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
311 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
312 1SJV 1 A r9 llama VHH single domain antibody 9844
313 1PW3 1 A, B immunoglobulin lambda chain variable region 9606
314 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
315 5JPJ 1 A, B 6aJL2 protein 9606
316 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
317 2UZI 2 L ANTI-RAS FV LIGHT CHAIN 9606
318 2I27 1 N, O New Antigen Receptor Ancestral variable domain 7801
319 3T0X 1 A, B Immunoglobulin variable lambda domain M8VLA4(S55P) 9606
320 1UA6 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
321 1UA6 2 H Ig VH,anti-lysozyme 10090
322 1IC7 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
323 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
324 4W68 1 A, B Single domain antibody 9844
325 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
326 1CFV 1 L MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
327 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
328 3EAK 1 A, B NbBCII10-FGLA 9838
329 1QP1 1 A, B, C BENCE-JONES KAPPA I ANTIBODY BRE (LIGHT CHAIN) IMMUNOGLOBULIN FRAGMENT, VARIABLE DOMAIN 9606
330 3U7A 1 A Amyloidogenic immunoglobulin light chain protein AL-09 Y32F Y96F, variable domain 9606
331 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
332 4ORZ 3 C single domain antibody sdAb19 9844
333 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
334 4UU9 2 B, L MEDI7814 VARIABLE DOMAIN LIGHT CHAIN 9606
335 3MOQ 1 A, B, C, D New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain CHIMERA OF NEW ANTIGEN RECEPTOR VARIABLE DOMAIN (RESIDUES 1-87 AND 102-113 FROM UNP Q6X1E6) INSERTED WITH AMYLOID BETA 18-41 (RESIDUES 689-712 FROM UNP P05067) 168098
336 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
337 1G7L 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
338 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
339 1BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
340 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
341 5C1M 2 B Nanobody 39 9844
342 5F7K 2 C, D Nanobody Nb-ER19 9844
343 5LMJ 1 A, B, C, D nanobody 9844
344 5E1H 2 B F8(JOB10) VHH antibody 30538
345 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
346 1IVL 1 A, B IGG-KAPPA M29B FV (LIGHT CHAIN) 10090
347 4OCM 3 C, F Nb1 9844
348 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
349 1A6U 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
350 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
351 4X7E 2 C, D Nano-85 Nanobody 30538
352 5F1O 2 B nanobody MU551 9844
353 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
354 5O03 2 C, D Nanobody (VHH) Nano-32 11983
355 2DQI 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
356 2DQI 2 H Ig VH,anti-lysozyme 10090
357 1BRE 1 A, B, C, D, E, F BENCE-JONES KAPPA I PROTEIN BRE 9606
358 4Y8D 2 C, D nanobody 9844
359 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
360 3CX5 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
361 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
362 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
363 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
364 4C58 2 B NANOBODY 9844
365 5B8C 1 A, D, G, J Pembrolizumab light chain variable region (PemVL) 9606
366 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
367 3DV6 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
368 3DV6 2 B Ig-like protein 10090
369 1VES 1 A, B New Antigen Receptor variable domain 168098
370 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
371 2EKS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
372 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
373 3BD5 1 A, B catalytic antibody 10090
374 5VXM 2 B Single-domain antibody 20ipaD 30538
375 4XVJ 2 H antibody heavy chain variable domain 9606
376 4XVJ 3 L antibody light chain variable domain 9606
377 1AC6 1 A, B T-CELL RECEPTOR ALPHA VARIABLE DOMAIN 10090
378 4IDL 1 A Single Domain Antibody VHH A9 9844
379 1JV5 1 A Ig kappa chain precursor V region anti-blood group A Fv 9606
380 1JV5 2 B Ig chain heavy chain precursor V region 9606
381 1FVC 1 A, C IGG1-KAPPA 4D5 FV (LIGHT CHAIN) 9606
382 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
383 3K7U 1 A Antibody 9844
384 4Z0X 1 A Antibody HC26AM light chain variable domain 9606
385 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
386 1IC5 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
387 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
388 4NBY 2 B, C A20.1 VHH 9844
389 4X7D 2 C, D Nano-85 Nanobody VHH 9844
390 2CD0 1 A, B PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) VARIABLE DOMAIN 9606
391 5F7N 2 C, D Nanobody Nb-ER19 30538
392 5OCL 1 A, C, F, H anti-llama nanobody 30538
393 5OCL 2 B, D, E, G anti-vglut nanobody 9844
394 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
395 4LAS 2 L Single light chain Variable fragment Light Chain 10090
396 2A9M 1 L, M fluorescein-scfv light chain 9606
397 2A9M 2 H, I fluorescein-scfv heavy chain 9606
398 2YWZ 1 A new antigen receptor variable domain 168098
399 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
400 1SJX 1 A immunoglobulin VH domain 9844
401 3ZKS 2 D XA4813 9844
402 1A6V 1 L, M, N B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
403 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
404 5MY6 2 B Nanobody 2Rs15d 9838
405 3DUS 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
406 3DUS 2 B, D Ig-like protein 10090
407 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
408 5NH3 3 L, M anti-human ActRIIB mAb BYM338 Fv light-chain 9606
409 5M2I 2 G, H, I, J, K, L VHH1 9844
410 2COQ 1 A new antigen receptor variable domain 168098
411 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
412 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
413 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
414 3K1K 2 C, D Enhancer 9838
415 4U7S 1 A, B sdAb A3 9844
416 4U3X 1 A, C Human VH domain antibody 9606
417 4W81 1 A Single Domain Antibody 9844
418 5GRV 1 L homo-specific diabody heavy chain 9606
419 5GRV 2 K homo-specific diabody light chain 9606
420 5JMR 1 A, B camelid VHH fragment 9838
421 4W70 1 A Single Domain Antibody 9844
422 2GSG 1 A, C monoclonal antibody light chain variable domain 10090
423 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
424 2W0L 1 A, B, C, D V1-22 PROTEIN 9606
425 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
426 5TBD 2 B, F, G, K Fv fragment (mAb4D1) heavy chain 10090
427 4BFB 2 D, E XA4813 9844
428 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
429 5DHV 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
430 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
431 4LVE 1 A, B LEN KAPPA-IV LIGHT CHAIN DIMER 9606
432 43C9 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
433 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
434 1NMB 2 L FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
435 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
436 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
437 1I8I 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
438 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
439 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
440 1OAR 2 L, M, N, O IMMUNOGLOBULING E FV, RESIDUES 1-110 10090
441 1D9K 1 A, E T-CELL RECEPTOR D10 (ALPHA CHAIN) 10090
442 4LHQ 2 B, D Camelid nanobody 30538
443 3DV4 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
444 3DV4 2 B Ig-like protein 10090
445 3ZKX 2 B XA4813 9844
446 3ZKX 3 C XA4815 9844
447 5F1K 2 C, D nanobody MU1053 9844
448 3ZLQ 2 C, D XA4813 9844
449 1I3G 1 L ANTIBODY FV FRAGMENT VL DOMAIN 10090
450 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
451 1DL7 1 L PROTEIN (ANTIBODY M3C65 (LIGHT CHAIN)) COMBINED LIGHT AND HEAVY CHAIN VIA (G4S)3 LINKER FV (SINGLE CHAIN) 10090
452 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
453 4NC0 2 B A26.8 VHH 9844
454 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
455 1OCW 2 L IMMUNOGLOBULIN E FV REGION, RESIDUES 1-120 10090
456 1IGM 1 L IGM-KAPPA POT FV (LIGHT CHAIN) 9606
457 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
458 5GS1 1 A, M, O, Q light chain 9606
459 5GS1 2 B, N, P, R heavy chain 9606
460 5F7Y 3 C, D Nanobody Nb-ER19 9844
461 2DQG 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
462 2DQG 2 H Ig VH,anti-lysozyme 10090
463 5IMO 1 B Nanobody 9835
464 5U65 1 A, B VHH-5 9838
465 2PXY 1 A T cell receptor alpha chain 10090
466 3BDX 1 A, B, C Amyloid lambda 6 light chain variable region PIP (fragment) Residues 1-111 9606
467 4TYU 1 A, B Single Domain Antibody 9844
468 43CA 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
469 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
470 2DQH 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
471 2DQH 2 H Ig VH,anti-lysozyme 10090
472 4AQ1 2 B, D NBKB6 VHH 9844
473 2Q1E 1 A, B, C, D Amyloidogenic immunoglobulin light chain protein AL-09 9606
474 4EIG 2 B CA1698 camel antibody fragment 9844
475 3EHB 3 C FV fragment Chain H 10090
476 3EHB 4 D FV fragment Chain L 10090
477 3HB3 3 C ANTIBODY FV FRAGMENT 10090
478 3HB3 4 D ANTIBODY FV FRAGMENT 10090
479 4FFY 1 L DENV1-E111 single chain variable fragment (light chain) 10090
480 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
481 4N1E 1 A, B, C, D, E, F, G, H immunoglobulin variable light chain domain 9606
482 2X89 1 A, B, C ANTIBODY 9838
483 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
484 5O04 2 E, F Nanobody (VHH) Nano-26 30538
485 5O04 3 C, D Nanobody (VHH) Nano-85 30538
486 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
487 5LBS 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 SCFV fragment, light chain 9606
488 3P9W 2 B, D, F, H human VEGF 9606
489 1AP2 1 A, C MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
490 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
491 5F8R 2 C, D Nanobody Nb-ER19 9844
492 1IC4 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
493 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
494 4OCL 3 C, F Nb1 9844
495 3CDY 1 A, B IMMUNOGLOBULIN LIGHT CHAIN 9606
496 4RAV 1 B, D Single-chain Fv, VL 9606
497 4RAV 2 A, C single-chain Fv, VH 9606
498 5LWY 2 H V REGION HEAVY CHAIN 10090
499 5LWY 3 L V REGION LIGHT CHAIN 10090
500 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
501 1KB9 11 K LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
502 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
503 4X4X 2 B, D Human Variable Light Chain of Herceptin 9606
504 2Z8V 2 C, D New antigen receptor variable domain 168098
505 4IOS 2 D, E, F, G Llama nanobody 11 9844
506 2W0K 1 A, B V1-22 PROTEIN 9606
507 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
508 2BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
509 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
510 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
511 2IBZ 11 Y Variable Light chain of antibody fragment 10090
512 4K3H 1 A, B, C, D, E, F, G, H Immunoglobulin lambda variable domain L5(L89S) 9606
513 4C57 2 C, D NANOBODY 9844
514 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
515 2Z8W 2 C, D New antigen receptor variable domain 168098
516 4OCN 3 C, F Nb1 9844
517 4GRW 3 E, G Nanobody 124C4 9844
518 4GRW 4 F, J Nanobody 37D5 9844
519 4GRW 5 H, I Nanobody 22E11 9844
520 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
521 4NC2 2 B B39 VHH 9844
522 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
523 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
524 2OI9 2 B T cell receptor alpha chain 10090
525 4HGM 1 A Shark V-NAR 7797
526 3BD4 1 A, B catalytic antibody 10090
527 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
528 1WT5 2 C, D ANTI EGFR ANTIBODY FV REGION VL fragment 9606
529 1JHL 1 L IGG1-KAPPA D11.15 FV (LIGHT CHAIN) 10090
530 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
531 5F9A 2 C Nanobody Nb-ER19 9844
532 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
533 4LLV 2 B, D, F, L 4E10 Fv light chain 9606
534 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
535 4LAR 2 L Single light chain variable fragment Light Chain 10090
536 5CBA 1 A, C 3b4 heavy chain 9606
537 5CBA 2 B, D 3b4 light chain 9606
538 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
539 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
540 1A14 3 L NC10 FV (LIGHT CHAIN) VL DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
541 1C08 1 A ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VL FRAGMENT 10090
542 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
543 2OTW 1 A, C Fv light chain avriable domain VL 10090
544 2OTW 2 B, D Fv heavy chain variable domain VH 10090
545 3STB 1 A, B single domain antibody VHH 9844
546 2YSS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
547 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
548 4W6W 2 B NbFedF6 9844
549 5JA8 2 B, D, F, H Nanobody 2 9844
550 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
551 2YBR 2 B, E, H SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN, RESIDUES 118-263 9606
552 2I26 1 N, O, P New Antigen Receptor Ancestral variable domain 7801
553 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
554 2BJM 2 L IGE SPE7 LIGHT CHAIN LIGHT CHAIN, RESIDUES 1-110 10090
555 2AP2 1 A, C PROTEIN (ANTIBODY (LIGHT CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
556 2AP2 2 B, D PROTEIN (ANTIBODY (HEAVY CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
557 1P4B 1 L Antibody Variable light chain 10090
558 1P4B 2 H Antibody Variable heavy chain 10090
559 5O0W 2 E, F, G, H Nb474 30538
560 4Y5V 1 A, D, G diabody 305 VH domain 9606
561 4Y5V 2 B, E, H Diabody 305 VL domain 9606
562 1I9E 1 A CYTOTOXIC TCELL VALPHA DOMAIN N-TERMINAL DOMAIN OF ALPHA CHAIN 10090
563 1DQL 1 L IGM MEZ IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN FRAGMENT 9606
564 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
565 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
566 3V0A 3 C Llama antibody F12 9844
567 2Z35 1 A T-cell receptor alpha-chain 10090
568 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
569 3K80 1 A, B Antibody 9844
570 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
571 5F8Q 2 C, D Nanobody Nb-ER19 9844
572 4U05 1 A, B Single Domain Antibody 9844
573 5F9D 2 C Nanobody Nb-ER19 9844
574 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
575 4X4Y 2 B, D Human Variable Light Chain of Herceptin 9606
576 4LGP 2 B, D VHH1 camelid nanobody 30538
577 2P48 2 B ANTIBODY CAB-RN05 9838
578 5VXK 1 B single-domain antibody JMK-H2 30538
579 5F7M 2 C, D Nanobody Nb-ER19 9844
580 1VER 1 A New Antigen Receptor variable domain 168098
581 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
582 5F7W 2 C, D Nanobody Nb-ER19 9844
583 4YQX 1 H, N JES6-1 VH domain 10116
584 4YQX 2 L, O JES6-1 VL domain 10116
585 1FO0 4 A PROTEIN (BM3.3 T CELL RECEPTOR ALPHA-CHAIN) FV FRAGMENT, VARIABLE DOMAIN 10090
586 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
587 1EZV 11 Y LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
588 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
589 3U6R 2 B, L Antibody 1:7 (Light chain) 9606
590 1U3H 1 A, E T-cell receptor alpha-chain V2.3-J39-C 10090
591 1KTR 1 L Anti-his tag antibody 3d5 variable light chain 10090
592 1KTR 3 H Anti-his tag antibody 3d5 variable heavy chain 10090
593 2YWY 1 A, B, C, D new antigen receptor variable domain 168098
594 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
595 1NMC 3 C, L SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
596 1KB5 1 A KB5-C20 T-CELL ANTIGEN RECEPTOR 24 RESIDUE LINK BETWEEN VALPHA C-TERMINUS AND VBETA N-TERMINUS FV FRAGMENT, VARIABLE DOMAIN 10090
597 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
598 4NC1 2 C, D A20.1 VHH 9844
599 4NC1 3 E, F A26.8 VHH 9844
600 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
601 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
602 2DQF 1 A, D lysozyme binding Ig kappa chain V23-J2 region 10090
603 2DQF 2 B, E Ig VH,anti-lysozyme 10090
604 1B88 1 A, B T CELL RECEPTOR V-ALPHA DOMAIN V-ALPHA DOMAIN 10090
605 5E7F 1 A, B, C nanobody L06 9838
606 2P46 2 B, D ANTIBODY CAB-RN05 9838
607 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
608 3CXH 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
609 2E7L 1 A, B Cytotoxic Tcell receptor UNP RESIDUES 21-132 10090
610 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
611 5LHP 2 B Camelid-Derived Antibody Fragment 30538
612 2ICW 5 I, K T-cell receptor alpha chain V residues 21-131 10090
613 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
614 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
615 1P84 11 K Light Chain (Vl) Of Fv-Fragment 10090
616 5SV4 1 A, B Single Domain Antibody A3C8 9844
617 4LGS 2 B Camelid nanobody (VHH4) 30538
618 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
619 2XTJ 2 B FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
620 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
621 5CBE 1 A, C E10 heavy chain 9606
622 5CBE 2 B, D E10 light chain 9606
623 2P47 2 B ANTIBODY CAB-RN05 9838
624 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
625 3WXW 2 H V region heavy chain 10090
626 3WXW 3 L V region light chain 10090
627 3K3Q 1 A llama Aa1 VHH domain 9844
628 1F6L 1 L ANTI-FERRITIN IMMUNOGLOBULIN LIGHT CHAIN VARIABLE LIGHT CHAIN 9606
629 3LRH 1 A, C, E, G, I, K, M, O anti-huntingtin VL domain anti-huntingtin VL domain 9606
630 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
631 1AR1 3 C ANTIBODY FV FRAGMENT 10090
632 1AR1 4 D ANTIBODY FV FRAGMENT 10090
633 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
634 1BVK 1 A, D HULYS11 FV 9606
635 1BVK 2 B, E HULYS11 FV 9606
636 5FV1 1 L, M VK DOMAIN ANTIBODY VK DOMAIN ANTIBODY, RESIDUES 1-108 9606
637 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
638 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
639 2CJU 2 L NQ16-113.8 ANTI-PHOX ANTIBODY 10090
640 5HVF 2 B VHH-i83 30538
641 1P4I 1 L ANTIBODY VARIABLE LIGHT CHAIN 10090
642 1P4I 2 H antibody variable heavy chain 10090
643 4PGJ 1 A, C Human heavy chain domain antibody 9606
644 2LVE 1 A RLEN KAPPA-IV LIGHT CHAIN DIMER 9606
645 4KDT 1 A, B Nanobody24 9835
646 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
647 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
648 2VH5 2 L ANTI-RAS FV LIGHT CHAIN 9606
649 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
650 5MJE 2 B Nanobody 8 9844
651 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
652 3LH2 3 L, M, N, O Fv 4E10 light chain 9606
653 3OGO 2 E, F, G, H GFP-nanobody 9838
654 4C59 2 B NANOBODY 9844
655 5VXL 2 B single-domain antibody JPS-G3 30538
656 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
657 1OAZ 3 L, N IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
658 4DK6 1 A, B single domain antibody VHH 9844
659 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
660 1CL7 2 H PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)) FAB 10090
661 5F7L 2 B, D Nanobody Nb-ER14 9844
662 1KJ2 4 A, D KB5-C20 T-Cell receptor alpha-chain Fv fragment , variable domain 10090
663 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
664 1OAY 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
665 5HVG 2 B, D VHH-a204 30538
666 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
667 4LAQ 2 L Single light chain variable fragment Light Chain 10090
668 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606 3.4.19.13 | Details
669 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
670 5HVH 2 B VHH-a204 30538
671 5HVH 3 C VHH-i83 30538
672 4XT1 3 C nanobody 7 30538
673 5LXG 2 H V REGION HEAVY CHAIN 10090
674 5LXG 3 L V REGION LIGHT CHAIN 10090
675 5HM1 1 A, B, C lama VHH antibody 2E7 9844
676 5FUC 3 E, V VHH6 9838
677 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
678 4RZC 2 B, D, F, L Fv M6P-1 heavy chain 9986
679 3H3P 1 H, I Fv 4E10 heavy chain 9606
680 3H3P 2 L, M Fv 4E10 light chain 9606
681 5O2U 2 B, D VHH 59H10 9844
682 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
683 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
684 3NN8 2 B, E, F, H Engineered scFv, light chain 10090
685 5OMN 2 C Nanobody (VHH) Nano-27 30538
686 4KRP 2 B Nanobody/VHH domain 9G8 9844
687 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
688 1OAX 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
689 4FHB 2 D Nb179 9844
690 4DK3 1 A, B single domain antibody VHH 9844
691 4KRL 1 B Nanobody/VHH domain 7D12 9844
692 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
693 4V1D 2 B SINGLE CHAIN ANTIBODY FRAGMENT LR, LIGHT CHAIN 9606
694 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
695 4V1D 5 E SINGLE CHAIN ANTIBODY FRAGMENT RU1, LIGHT CHAIN 9606
696 2Z31 1 A T-cell receptor alpha-chain 10090
697 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
698 1NMA 2 L FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
699 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
700 1NAM 1 A BM3.3 T Cell Receptor alpha-Chain Fv Fragment, Variable Domain 10090
701 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
702 4LDE 2 B Camelid Antibody Fragment 9844
703 4Y5Y 1 A, D diabody 330 VH domain 9606
704 4Y5Y 2 B, E diabody 330 VL domain 9606
705 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
706 1BVL 1 A, C HULYS11 FV 10090
707 1BVL 2 B, D HULYS11 FV 10090
708 3RJQ 2 B Llama VHH A12 9844
709 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
710 4UNT 1 A, B, C, D, E, F, G, H IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
711 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
712 3AB0 3 C, F antibody ScFv fragment, light chain 10090
713 3LHP 1 H, I Fv 4E10 heavy chain 9606
714 3LHP 2 L, M Fv 4E10 light chain 9606
715 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
716 2BX5 1 A, B, C, D, E, F, G, H, I, J, K, L, M, N, O VD9 VKI LIGHT-CHAIN LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
717 6EQI 2 B Nb696 9844
718 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
719 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
720 4KFZ 2 C, D Anti-LMO2 VH 9606 3.4.19.13 | Details
721 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
722 2UUD 2 K, L NQ10-1.12 ANTI-PHOX ANTIBODY 10090
723 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
724 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
725 4Y5X 2 B, E, H, K diabody 310 VH domain 9606
726 4YGA 2 B, D, F, H VHH-1B7 30538
727 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
728 4UT9 3 L, M, N, O BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, LIGHT CHAIN DOMAIN 9606
729 2A9N 1 L, M fluorescein-scfv light chain 9606
730 2A9N 2 H, I fluorescein-scfv heavy chain 9606
731 5XQY 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 Y96K mutant of REI VL 9606
732 5GS0 2 C, E light chain (anti-TLR3) 10090
733 5GS0 3 D, F heavy chain (anti-TLR3) 10090
734 5GS0 4 H, X heavy chain (anti-Lid) 10090
735 5GS0 5 L, Y light chain (anti-Lid) 10090
736 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
737 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
738 1KYO 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT RESIDUES 1-107 10090
739 5GRJ 1 H avelumab H chain 9606
740 5GRJ 2 L avelumab L chain 9606
741 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
742 4NKD 2 B, D, F, H Engineered scFv light chain 10090
743 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
744 4KRO 2 B Nanobody/VHH domain EgA1 9844
745 3WXV 2 H V region heavy chain 10090
746 3WXV 3 L V region light chain 10090
747 1AR2 1 A REI VARIABLE REGION, LIGHT CHAIN 9606
748 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
749 4KV5 3 F, I, K, L light chain GC1009 scFv 9606
750 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
751 5TJW 2 K NP-specific inhibitory VHH 30538
752 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
753 1QLE 6 L LIGHT CHAIN ANTIBODY FV FRAGMENT 10090
754 4LDL 2 B Camelid Antibody Fragment 9844
755 3E3Q 3 C, D, I, M, R, V, Z, d T-cell receptor alpha chain V region PHDS58 10090
756 5XP1 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 UNP residues 22-117 9606
757 4LDO 2 B Camelid Antibody Fragment 9844
758 3SN6 5 N Camelid antibody VHH fragment 9844
759 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
760 4M8Q 1 A, H GEP1 Fv heavy chain 9606
761 4M8Q 2 B, L GEP1 Fv light chain UNP residues 21-129 9606
762 5NHR 1 B, L Bimagrumab Fv Light-Chain VL domain LIGAND BINDING domain 9606
763 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
764 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
765 5O8F 2 K, O Nanobody Nb25 9844
766 5O8F 3 L, M, N Nanobody Nb25 9844
767 5C3L 4 D Nanobody Nb15 Nanobody 9838
768 5J3H 2 C mAb 83-7 Fab heavy chain 10090
769 5J3H 3 D mAb 83-7 Fab light chain 10090
770 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
771 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
772 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
773 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
774 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
775 4PIR 2 F, G, H, I, J VHH15 9844
776 4QKX 2 B R9 protein 9844
777 5JQH 2 C, D Nanobody60, Nb60 9844
778 4YBQ 2 C, E antibody Fv fragment light chain 10090
779 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
780 4PD4 10 J Igh protein 10090
781 4PD4 11 K Ig kappa chain V-V region HP 124E1 10090
782 5DA0 2 B Nanobody 9844
783 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
784 4R0L 3 B, L Antibody 1C6 Light chain UNP residues 20-137 10090
785 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
786 4ODX 2 A, H GEP7 Fv heavy chain 9606
787 4ODX 3 B, L GEP7 Fv light chain 9606
788 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
789 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
790 3E2H 3 B T-cell receptor alpha chain V region PHDS58 10090
791 4H1L 4 G, I Ani2.3 TCR A chain 562
792 1RVF 5 L FAB 17-IA 10090
793 1RVF 6 H FAB 17-IA 10090
794 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
795 5JZ7 3 D, I, K, L MEDI578 scFv, light chain 9606
796 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
797 4MQS 2 B Nanobody 9-8 9844
798 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
799 5DHY 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
800 1QFW 3 L ANTIBODY (ANTI ALPHA SUBUNIT) (LIGHT CHAIN) FV 10090
801 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
802 1QFW 5 M ANTIBODY (ANTI BETA SUBUNIT) (LIGHT CHAIN) FV 10090
803 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
804 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
805 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
806 4OGA 4 D monoclonal antibody fab 83-7 fragment - light chain 10090
807 4MQT 2 B Nanobody 9-8 9844
808 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
809 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
810 4NKM 2 B, D, F, H Engineered scFv light chain 10090
811 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
812 3W11 4 D monoclonal antibody fab 83-7 fragment - light chain 10090
813 4NKO 1 A, C, E Engineered scFv light chain 10090
814 4NKO 2 B, D, F Engineered scFv heavy chain 10090
815 5EUL 4 V AYC08 30538
816 5GXB 2 B nanobody 30538
817 5NBD 2 C Nanobody 9844
818 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
819 3W13 3 D monoclonal antibody fab 83-7 fragment - light chain 10090
820 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
821 3W12 3 D monoclonal antibody fab 83-7 fragment - light chain 10090
822 5H8O 1 A VHH nanobody 9844
823 4KSD 2 B R2 protein 9844
824 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
825 5DHZ 2 L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
826 2A0L 2 C, E 33H1 Fv fragment Fv fragment,light chain 10090
827 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
828 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
829 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
830 5TD8 5 E nanobody 30538
831 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
832 5Y0A 3 E, G, L variable region of Fab ZKA190 light chain 9606
833 5XS7 1 L Light chain of Fab 1D5 10090
834 5XS7 2 H Heavy chain of Fab 1D5 10090
835 5W3L 5 E C5 antibody variable heavy domain 10090
836 5W3L 6 G C5 antibody variable light domain 10090
837 5W3M 1 E C5 antibody variable heavy domain 10090
838 5W3M 2 G C5 antibody variable light domain 10090
839 5W3O 1 D C5 antibody variable heavy domain 10090
840 5W3O 2 E C5 antibody variable light domain 10090
841 5W3E 1 E C5 antibody variable heavy domain 10090
842 5W3E 2 G C5 antibody variable light domain 10090
843 5VAI 6 N nanobody 35 9844
844 5UZ7 4 N NANOBODY 35 9844
845 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
846 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
847 5TR1 3 L, M Monoclonal antibody, Fab fragment, light chain 10090
848 5TQQ 2 L, M Monoclonal antibody, Fab fragment, light chain 10090
849 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
850 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
851 5H32 3 H, L, M C10 IgG light chain variable region 9606
852 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
853 5H37 4 H, L, M C10 IgG light chain variable region 9606
854 5H30 3 G, I, K IgG C10 heavy chain 9606
855 5H30 4 H, L, M IgG C10 light chain 9606
856 5KWL 4 7 VHH 10E 9838
857 5KTZ 4 7 VHH 12B 9838
858 5KU0 4 7 VHH 17B 9838
859 5KU2 4 7 VHH 7A 9838
860 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
861 5KEL 4 L, T, U c2G4 variable Fab domain light chain 9606
862 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
863 5KEL 6 D, N, O c13C6 variable Fab domain light chain 9606
864 5KEM 1 C, H BDBV91 variable Fab domain light chain 9606
865 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
866 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
867 5KEM 4 E, J c13C6 variable Fab domain light chain 9606
868 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
869 5KEN 4 D, H, O c4G7 variable Fab domain light chain 9606
870 5KEN 5 I, P c13C6 variable Fab domain light chain 9606
871 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
872 3JCX 2 H Fab E heavy chain 10116
873 3JCX 3 L Fab E light chain 10116
874 5FOJ 1 A NANOBODY 9838
875 3JBC 5 7 nanobody VHH PVSP29F 9838
876 3JBD 5 7 nanobody VHH PVSP6A 9838
877 3JBE 5 7 nanobody VHH PVSS8A 9838
878 3JBF 5 7 nanobody VHH PVSP19B 9838
879 3JBG 5 7 nanobody VHH PVSS21E 9838
880 3JBA 1 L H16.U4 antibody light chain Fab variable domain 10090
881 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
882 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
883 3JAU 3 L Light chain of Fab fragment variable region of antibody D5 10090
884 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
885 5A1Z 4 H, J, L ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - LIGHT CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
886 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
887 4UIF 4 H, J, L ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - LIGHT CHAIN 9606
888 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
889 4UIH 3 E, G ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -LIGHT CHAIN 9606
890 4UDF 3 10, 14, 18, 1C, 1G, 1K, 1O, 1S, 1W, 20, 24, 28, 2C, 2G, 2K, 2O, 2S, 2W, 30, 34, 38, 3C, 3G, 3K, 3O, 3S, 3W, 40, 44, 48, 4C, 4G, 4K, 4O, 4S, 4W, 50, 54, 58, 5C, 5G, 5K, 5O, 5S, 5W, 60, 64, 68, 6C, 6G, 6K, 6O, 6S, 6W, 7C, 7G, 7K, 7O, 7S, 7W HUMAN MONOCLONAL ANTIBODY 9606
891 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
892 3J8Z 2 J, K, L, M H16.1A light chain variable domain Fab 10090
893 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
894 3J8V 2 J, K, L, M H16.14J light chain variable domain Fab 10090
895 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
896 3J8W 1 J, K, L, M H263.A2 light chain variable domain Fab 10090
897 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
898 3J7E 1 A, C, E, L H16.V5 Fab light chain variable domain 10090
899 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
900 3J6U 3 H Fab 5J7 heavy chain variable region 9606
901 3J6U 4 L Fab 5J7 light chain variable region 9606
902 2MMX 1 A V1-22 protein 9606
903 2MKW 1 A V1-22 protein 9606
904 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
905 4CKD 3 L, M, N, O SCFV13R4 ANTIBODY FV LIGHT CHAIN 10090
906 2KQM 1 A, B Ig kappa chain V-I region AU Immunoglobulin kappa light chain 9606
907 2KQN 1 A, B Ig kappa chain V-I region AU Immunoglobulin kappa light chain 9606
908 3IY1 1 A Fab B, light chain antibody B fragment 10116
909 3IY1 2 B Fab B, heavy chain 10116
910 3IY2 1 A Antibody 6, light chain fragment of antibody 6 10090
911 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
912 3IY3 1 A antibody fragment from neutralizing antibody 8 (light chain) FAb 8 10090
913 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
914 3IY4 1 A fragment of neutralizing antibody 15 (light chain) fragment of neutralizing antibody 15 10090
915 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
916 3IY5 1 A antibody fragment IGG2A (light chain) Fab 10090
917 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
918 3IY6 1 A fragment from neutralizing antibody E (light chain) FAb E 10116
919 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
920 3IY7 1 A fragment from neutralizing antibody F (light chain) FAb F 10116
921 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
922 3IY0 1 L Fab 14, light domain Fab14 10090