Sequence Similarity Clusters for the Entities in PDB 1KXV

Entity #1 | Chains: A,B
ALPHA-AMYLASE, PANCREATIC protein, length: 496 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 6879
95 % 3 17 2607 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.5
PDBFlex
90 % 3 17 2653
70 % 16 77 580
50 % 17 81 591
40 % 17 90 565
30 % 17 90 565
Entity #2 | Chains: C,D
CAMELID VHH DOMAIN CAB10 protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 45565
95 % 1 1 34115 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.5
PDBFlex
90 % 1 1 32616
70 % 1 1 29060
50 % 72 566 7
40 % 103 916 5
30 % 113 1042 7

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4UNU 1 A, B IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
2 5IVN 1 A BC2-nanobody 30538
3 5ACM 1 A, B MCG IG LAMBDA CHAIN V-II REGION MGC 9606
4 5E7B 1 A nanobody nano-L06 9838
5 2P45 2 B ANTIBODY CAB-RN05 9838
6 2X1Q 1 A, B GELSOLIN NANOBODY 9844
7 5U64 1 B VHH-28 9838
8 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
9 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
10 4B41 1 A, B ANTIBODY G7 9844
11 5IMM 1 B Nanobody 9835
12 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
13 4QYO 2 B Fv fragment(mAb6D8) light chain 10090
14 5NLU 1 A single domain llama antibody Nb36 9844
15 2Q20 1 A, B Vk1 O18/O8 germline light chain variable domain 9606
16 1MQK 1 L antibody 7E2 FV fragment, light chain 10090
17 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
18 5IMK 1 B Nanobody 9835
19 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
20 4B50 1 A 2H10 LLAMA VHH 9844
21 2XT1 2 B CAMELID VHH 9 30538
22 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
23 4QY8 2 B Fv fragment(mAb6D8) light chain 10090
24 5J1S 3 C VHH domain BS-2 30538
25 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
26 2I24 1 N New Antigen Receptor PBLA8 variable domain 7801
27 5L6Q 1 A, B H5AL 9606
28 5J1T 3 C VHH domain BS-2 30538
29 2X1O 1 A, B GELSOLIN NANOBODY 9844
30 4QGY 1 A, B nanobody n25, VH domain 9844
31 5C2B 1 H scFv 3B4 heavy chain 9606
32 5C2B 2 L 3B4 light chain 9606
33 5DXW 1 A PD-L1 nanobody 10090
34 3T0W 1 A, B immunoglobulin variable lambda domain 9606
35 4N9O 2 B Nanobody Nb484 Nb484 9844
36 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
37 5ACL 1 A MCG IG LAMBDA CHAIN V-II REGION MGC 9606
38 3T0V 1 A immunoglobulin variable lambda domain 9606
39 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
40 1OAQ 2 L LIGHT CHAIN FV, RESIDUES 1-120 10090
41 1T2J 1 A M12-Variable Heavy domain 9606
42 1DLF 1 L ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
43 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
44 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
45 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
46 1SQ2 2 N novel antigen receptor 7801
47 4KML 2 B Nanobody 9844
48 4Z9K 2 B VHH2(F5) antibody 30538
49 1J05 1 A, L anti-CEA mAb T84.66, light chain Fv fragment 10090
50 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
51 5LMW 1 A Nanobody 9844
52 5NM0 1 A, B, C, D Nb36 9844
53 2RHE 1 A BENCE-JONES PROTEIN RHE (LIGHT CHAIN) 9606
54 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
55 4QXT 2 B Fv fragment(mAb6D8) light chain 10090
56 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
57 4PPT 1 A Engineered single domain VHH antibody 9844
58 3R0M 1 A, B Llama VHH A12 9844
59 3ZKQ 2 D XA4813 9844
60 4I13 2 B Protein ca1697 (nanobody) 9844
61 5C2U 1 B Nanobody Nanobody 9838
62 1XFP 1 A heavy chain antibody VHH domain 9838
63 4POY 1 A VHH-metal 9844
64 1A2Y 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
65 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
66 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
67 5NLW 1 A nanobody Nb36 9844
68 3CDC 1 A, B Light Chain Amyloidogenic 9606
69 3CDF 1 A, B, C, D, E, F IMMUNOGLOBULIN LIGHT CHAIN 9606
70 3DVI 1 A Amyloidogenic light chain variable domain AL-103 9606
71 2DLF 1 L PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN)) FV FRAGMENT (VL DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
72 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
73 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
74 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
75 3G9A 2 B Minimizer 9838
76 1EEQ 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
77 3U79 1 A, B, C, D, E, F, G, H Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain 9606
78 2P43 2 B ANTIBODY CAB-RN05 9838
79 4KRN 1 A Nanobody/VHH domain EgA1 9844
80 4GFT 2 B Nanobody 9844
81 4TVS 2 a, b VHH Domain BS-1 30538
82 4W6Y 2 B Nanobody NbFedF9 9844
83 1UAC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
84 1UAC 2 H Ig VH,anti-lysozyme 10090
85 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
86 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
87 4R3S 2 B FV FRAGMENT(MAB6D8) LIGHT CHAIN 10090
88 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
89 1EEU 1 A, B KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
90 5O02 2 C Nanobody (VHH) Nano-4 30538
91 4UNV 1 A IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
92 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
93 4X7F 2 C, D Nano-25 Nanobody 30538
94 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
95 4UT7 2 L BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV LIGHT CHAIN DOMAIN, RESIDUES 1-147 9606
96 4LGR 2 B Camelid nanobody (VHH3) 30538
97 5J57 2 B VHH single chain antibody V5E1 30538
98 1MFA 1 L IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN) 10090
99 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
100 5OMM 2 C Nanobody (VHH) Nano-14 30538
101 5E03 1 A mouse CTLA-4 nanobody 10090
102 5LZ0 1 A, B PorM nanobody 9844
103 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
104 2XXC 1 B CAMELID VHH 9 30538
105 3QYC 1 A, B VH domain of IgG molecule 9606
106 2XXM 2 B CAMELID VHH 9 30538
107 5IR3 1 A Ig lambda chain V-VI region AR 9606
108 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
109 4AJ0 1 A, B, C, D GERMINAL LINE LAMBDA 3 3RCW VARIANT VARIABLE DOMAIN VARIANT OF 3RJL2, RESIDUES 1-107 9606
110 5JDS 1 B Nanobody 9835
111 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
112 4OB5 2 L 4E10 antibody germline precursor 7 light chain Fv 9606
113 1BWW 1 A, B PROTEIN (IG KAPPA CHAIN V-I REGION REI) IMMUNOGLOBULIN KAPPA LIGHT CHAIN 9606
114 5L8L 2 B New antigen receptor variable domain 168098
115 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
116 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
117 4AIZ 1 A, C, D V2-17 PROTEIN 9606
118 4AIZ 2 B V2-17 PROTEIN 9606
119 5L21 2 B VHH-C2 30538
120 5FWO 1 A NANOBODY 9844
121 5KVE 2 L ZV-48 Antibody scFv Light Chain 10090
122 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
123 4L1H 1 A Ig kappa chain V-I region Rei 9606
124 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
125 3B9V 1 A, B, C, D heavy chain variable domain 9606
126 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
127 1VFA 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
128 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
129 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
130 2D7T 2 L anti polyhydroxybutyrate antibody Fv, light chain residues 1-110 9606
131 3BD3 1 A, B catalytic antibody 10090
132 2OTU 1 A, C, E, G Fv light chain variable domain 10090
133 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
134 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
135 1EFQ 1 A KAPPA-4 IMMUNOGLOBULIN (LIGHT CHAIN) 9606
136 5L8J 2 B New antigen receptor variable domain 168098
137 1T6V 2 N, O novel antigen receptor 7801
138 2E27 1 L anti-ciguatoxin antibody, light chain Fv fragment 10090
139 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
140 4N1C 1 A, B immunoglobulin variable light chain domain 9606
141 4POU 2 B VHH Antibody 9844
142 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
143 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
144 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
145 4AIX 1 A, B, C, D IG LAMBDA CHAIN V-IV REGION BAU 9606
146 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
147 2P42 2 B, D ANTIBODY CAB-RN05 9838
148 1I8K 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
149 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
150 4QLR 1 A, B Llama nanobody n02 VH domain 9844
151 5J56 2 B VHH single chain antibody V1C7 30538
152 4X4Z 1 A, B Herceptin VL domain with F53D mutation 9606
153 4NBX 2 B A20.1 VHH 9844
154 1G7J 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
155 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
156 4HEP 2 G vHH17 domain 9844
157 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
158 1PEW 1 A, B Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN 9606
159 1VFB 1 A IGG1-KAPPA D1.3 FV (LIGHT CHAIN) 10090
160 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
161 5IML 2 B Nanobody 9835
162 3A6C 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
163 3A6C 2 H IG VH, anti-lysozyme 10090
164 2DQD 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
165 2DQD 2 H Ig VH,anti-lysozyme 10090
166 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
167 1WTL 1 A, B BENCE-JONES PROTEIN MCG (LIGHT CHAIN) 9606
168 2I25 1 N, O New Antigen Receptor PBLA8 variable domain 7801
169 1G7I 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
170 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
171 3A67 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
172 3A67 2 H IG VH, anti-lysozyme 10090
173 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
174 1J1X 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
175 1J1X 2 H Ig VH,anti-lysozyme 10090
176 5L8K 2 B New antigen receptor variable domain 168098
177 5M2J 2 D Anti-(ED-B) scFV 9606
178 2DQC 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
179 2DQC 2 H Ig VH,anti-lysozyme 10090
180 1J1O 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
181 1J1O 2 H Ig VH,anti-lysozyme 10090
182 1MVU 1 A Ig kappa-chain VJ-region (Light chain) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
183 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
184 4M62 1 L, M GEP2 FV light chain UNP residues 21-129 9606
185 4M62 2 H, I GEP2 FV heavy chain 9606
186 5IVO 1 A BC2-nanobody 30538
187 1J1P 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
188 1J1P 2 H Ig VH,anti-lysozyme 10090
189 4NBZ 2 B, D A26.8 VHH 9844
190 1QAC 1 A, B IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN VARIABLE DOMAIN 9606
191 5AYU 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
192 5AYU 2 H Ig VH,anti-lysozyme 10090
193 3A6B 1 L Lysozyme binding ig kappa chain V23-J2 region 10090
194 3A6B 2 H IG VH, anti-lysozyme 10090
195 2DQJ 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
196 2DQJ 2 H Ig VH,anti-lysozyme 10090
197 5F21 2 B nanobody MU375 9844
198 1N4X 1 L, M immunoglobulin kappa chain variable region 10090
199 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
200 2P44 2 B ANTIBODY CAB-RN05 9838
201 3DVF 1 A Amyloidogenic immunoglobulin light chain protein AL-12 9606
202 1KIQ 1 A MONOCLONAL ANTIBODY D1.3 10090
203 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
204 5TP3 1 A, B F-VHH-4 9844
205 2IMN 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
206 3B5G 1 A, B AMYLOID LAMBDA 6 LIGHT CHAIN VARIABLE REGION PIP residues 1-111 9606
207 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
208 4LHJ 2 B Camelid antibody 30538
209 4BEL 2 D, E XA4813 9844
210 5M7Q 1 A, B Nanobody NbD2 9838
211 5H8D 1 A VHH nanobody 9844
212 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
213 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
214 3DUR 1 A, C antibody Fv fragment SAG173-04 variable region fragment (Fv) 10090
215 3DUR 2 B, D Ig-like protein 10090
216 5T93 1 A, B, C, D ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient last residue was not visible on electron density 9606
217 2XV6 2 B, D CAMELID VHH 9 30538
218 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
219 1LVE 1 A LEN, A VARIABLE DOMAIN FROM KAPPA-4 TYPE 9606
220 4ZG1 1 A, B, C, D, E, F NB17 9844
221 2IMM 1 A IGA-KAPPA MCPC603 FV (LIGHT CHAIN) 10090
222 4I1N 2 B Protein ca1697 (nanobody) 9844
223 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
224 5C9K 1 A, B, C, D, E, F, G, H Amyloid lambda 6 light chain variable region PIP 9606
225 1FGV 1 L H52 FV (LIGHT CHAIN) 9606
226 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
227 4LCI 1 L anti canine CD28 antibody, 1C6, light chain 10090
228 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
229 4W6X 2 B Nanobody NbFedF7 9844
230 5JA9 2 A, B Nanobody 6 9844
231 1A7N 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
232 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
233 1CD0 1 A, B PROTEIN (JTO, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) IMMUNOGLOBULIN VARIABLE DOMAIN 9606
234 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
235 1OP9 1 A HL6 camel VHH fragment 9838
236 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
237 4LRN 1 H GEP 1 heavy chain 9606
238 4LRN 2 L GEP 1 light chain 9606
239 4S11 1 A GELSOLIN NANOBODY 9844
240 1EK3 1 A, B KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL KAPPA-4 IMMUNOGLOBULIN LIGHT CHAIN VL, REC 9606
241 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
242 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
243 2YC1 2 B, E SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN 9606
244 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
245 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
246 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
247 1G7H 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
248 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
249 4Y7M 1 A, B Hi113 protein 9844
250 5JMO 2 C, D camelid VHH fragment 9838
251 1A7O 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
252 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
253 1KIR 1 A MONOCLONAL ANTIBODY D1.3 10090
254 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
255 4B5E 1 A, B PS2-8 9844
256 2DQE 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
257 2DQE 2 H Ig VH,anti-lysozyme 10090
258 1DVF 1 A FV D1.3 IGG1, KAPPA 10090
259 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
260 1DVF 3 C FV E5.2 IGG1, KAPPA 10090
261 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
262 1G7M 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
263 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
264 4X7C 2 C, D Nano-85 Nanobody VHH 30538
265 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
266 1OAU 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
267 1B0W 1 A, B, C BENCE-JONES KAPPA I PROTEIN BRE VARIABLE DOMAIN OF LIGHT CHAIN 9606
268 3EBA 1 A CAbHul6 9838
269 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606 3.4.19.13 | Details
270 1A6W 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
271 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
272 1A7R 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
273 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
274 1WZ1 1 L Ig light chain 10090
275 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
276 3UPA 1 A, B kappa light chain variable domain 9606
277 4I0C 2 C, D cAbHuL5 antibody 9838
278 3LVE 1 A LEN KAPPA-IV LIGHT CHAIN DIMER 9606
279 1A7P 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
280 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
281 4K3G 1 A, B immunoglobulin lambda variable domain L5(L89S) 9606
282 1XIW 3 C, G immunoglobulin light chain variable region 10090
283 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
284 1A7Q 1 L IGG1-KAPPA D1.3 FV (LIGHT CHAIN) FV FRAGMENT 10090
285 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
286 5BOP 1 A, C Nanobody 9844
287 4DKA 1 A, B single domain antibody VHH 9844
288 5O05 1 C, D Nanobody (VHH) Nano-42 30538
289 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606 3.4.19.13 | Details
290 1DSF 1 L ANTICANCER ANTIBODY B1 FV 10090
291 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
292 3DUU 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
293 3DUU 2 B, D Ig-like protein 10090
294 3BJ9 1 1 Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1 Fusion protein consists of Ig domain of VPREB protein and J-fragment of Ig lambda-5 9606
295 1H5B 1 A MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
296 1H5B 2 B, D MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
297 1H5B 3 C MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN C-TERMINAL HEXA-HISTIDINE TAG V-ALPHA DOMAIN VA85.33 (AV11S5-AJ17) 10090
298 3LRG 1 A, B anti-huntingtin VL domain anti-huntingtin VL domain 9606
299 3K74 2 B Nanobody 9844
300 1KIP 1 A MONOCLONAL ANTIBODY D1.3 10090
301 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
302 5LVE 1 A BENCE-JONES PROTEIN LEN G KAPPA CHAIN V-IV, VARIABLE DOMAIN, LIGHT CHAIN 9606
303 2EIZ 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
304 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
305 1SJV 1 A r9 llama VHH single domain antibody 9844
306 1PW3 1 A, B immunoglobulin lambda chain variable region 9606
307 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
308 5JPJ 1 A, B 6aJL2 protein 9606
309 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
310 2UZI 2 L ANTI-RAS FV LIGHT CHAIN 9606
311 2I27 1 N, O New Antigen Receptor Ancestral variable domain 7801
312 3T0X 1 A, B Immunoglobulin variable lambda domain M8VLA4(S55P) 9606
313 1UA6 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
314 1UA6 2 H Ig VH,anti-lysozyme 10090
315 1IC7 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
316 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
317 4W68 1 A, B Single domain antibody 9844
318 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
319 1CFV 1 L MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
320 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
321 3EAK 1 A, B NbBCII10-FGLA 9838
322 1QP1 1 A, B, C BENCE-JONES KAPPA I ANTIBODY BRE (LIGHT CHAIN) IMMUNOGLOBULIN FRAGMENT, VARIABLE DOMAIN 9606
323 3U7A 1 A Amyloidogenic immunoglobulin light chain protein AL-09 Y32F Y96F, variable domain 9606
324 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
325 4ORZ 3 C single domain antibody sdAb19 9844
326 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
327 4UU9 2 B, L MEDI7814 VARIABLE DOMAIN LIGHT CHAIN 9606
328 3MOQ 1 A, B, C, D New antigen receptor variable domain,P3(40) peptide from Amyloid beta A4 protein,New antigen receptor variable domain CHIMERA OF NEW ANTIGEN RECEPTOR VARIABLE DOMAIN (RESIDUES 1-87 AND 102-113 FROM UNP Q6X1E6) INSERTED WITH AMYLOID BETA 18-41 (RESIDUES 689-712 FROM UNP P05067) 168098
329 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
330 1G7L 1 A ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 LIGHT CHAIN 10090
331 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
332 1BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
333 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
334 5C1M 2 B Nanobody 39 9844
335 5F7K 2 C, D Nanobody Nb-ER19 9844
336 5LMJ 1 A, B, C, D nanobody 9844
337 5E1H 2 B F8(JOB10) VHH antibody 30538
338 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
339 1IVL 1 A, B IGG-KAPPA M29B FV (LIGHT CHAIN) 10090
340 4OCM 3 C, F Nb1 9844
341 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
342 1A6U 1 L B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
343 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
344 4X7E 2 C, D Nano-85 Nanobody 30538
345 5F1O 2 B nanobody MU551 9844
346 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
347 5O03 2 C, D Nanobody (VHH) Nano-32 11983
348 2DQI 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
349 2DQI 2 H Ig VH,anti-lysozyme 10090
350 1BRE 1 A, B, C, D, E, F BENCE-JONES KAPPA I PROTEIN BRE 9606
351 4Y8D 2 C, D nanobody 9844
352 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
353 3CX5 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
354 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
355 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
356 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
357 4C58 2 B NANOBODY 9844
358 5B8C 1 A, D, G, J Pembrolizumab light chain variable region (PemVL) 9606
359 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
360 3DV6 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
361 3DV6 2 B Ig-like protein 10090
362 1VES 1 A, B New Antigen Receptor variable domain 168098
363 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
364 2EKS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
365 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
366 3BD5 1 A, B catalytic antibody 10090
367 5VXM 2 B Single-domain antibody 20ipaD 30538
368 4XVJ 2 H antibody heavy chain variable domain 9606
369 4XVJ 3 L antibody light chain variable domain 9606
370 1AC6 1 A, B T-CELL RECEPTOR ALPHA VARIABLE DOMAIN 10090
371 4IDL 1 A Single Domain Antibody VHH A9 9844
372 1JV5 1 A Ig kappa chain precursor V region anti-blood group A Fv 9606
373 1JV5 2 B Ig chain heavy chain precursor V region 9606
374 1FVC 1 A, C IGG1-KAPPA 4D5 FV (LIGHT CHAIN) 9606
375 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
376 3K7U 1 A Antibody 9844
377 4Z0X 1 A Antibody HC26AM light chain variable domain 9606
378 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
379 1IC5 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
380 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
381 4NBY 2 B, C A20.1 VHH 9844
382 4X7D 2 C, D Nano-85 Nanobody VHH 9844
383 2CD0 1 A, B PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN) VARIABLE DOMAIN 9606
384 5F7N 2 C, D Nanobody Nb-ER19 30538
385 5OCL 1 A, C, F, H anti-llama nanobody 30538
386 5OCL 2 B, D, E, G anti-vglut nanobody 9844
387 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
388 4LAS 2 L Single light chain Variable fragment Light Chain 10090
389 2A9M 1 L, M fluorescein-scfv light chain 9606
390 2A9M 2 H, I fluorescein-scfv heavy chain 9606
391 2YWZ 1 A new antigen receptor variable domain 168098
392 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
393 1SJX 1 A immunoglobulin VH domain 9844
394 3ZKS 2 D XA4813 9844
395 1A6V 1 L, M, N B1-8 FV (LIGHT CHAIN) FV FRAGMENT 10090
396 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
397 5MY6 2 B Nanobody 2Rs15d 9838
398 3DUS 1 A, C antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
399 3DUS 2 B, D Ig-like protein 10090
400 5M2I 2 G, H, I, J, K, L VHH1 9844
401 2COQ 1 A new antigen receptor variable domain 168098
402 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
403 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
404 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
405 3K1K 2 C, D Enhancer 9838
406 4U7S 1 A, B sdAb A3 9844
407 4U3X 1 A, C Human VH domain antibody 9606
408 4W81 1 A Single Domain Antibody 9844
409 5GRV 1 L homo-specific diabody heavy chain 9606
410 5GRV 2 K homo-specific diabody light chain 9606
411 5JMR 1 A, B camelid VHH fragment 9838
412 4W70 1 A Single Domain Antibody 9844
413 2GSG 1 A, C monoclonal antibody light chain variable domain 10090
414 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
415 2W0L 1 A, B, C, D V1-22 PROTEIN 9606
416 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
417 5TBD 2 B, F, G, K Fv fragment (mAb4D1) heavy chain 10090
418 4BFB 2 D, E XA4813 9844
419 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
420 5DHV 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
421 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
422 4LVE 1 A, B LEN KAPPA-IV LIGHT CHAIN DIMER 9606
423 43C9 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
424 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
425 1NMB 2 L FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
426 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
427 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
428 1I8I 1 A EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN 10090
429 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
430 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
431 1OAR 2 L, M, N, O IMMUNOGLOBULING E FV, RESIDUES 1-110 10090
432 1D9K 1 A, E T-CELL RECEPTOR D10 (ALPHA CHAIN) 10090
433 4LHQ 2 B, D Camelid nanobody 30538
434 3DV4 1 A antibody Fv fragment SAG506-01 variable region fragment (Fv) 10090
435 3DV4 2 B Ig-like protein 10090
436 3ZKX 2 B XA4813 9844
437 3ZKX 3 C XA4815 9844
438 5F1K 2 C, D nanobody MU1053 9844
439 3ZLQ 2 C, D XA4813 9844
440 1I3G 1 L ANTIBODY FV FRAGMENT VL DOMAIN 10090
441 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
442 1DL7 1 L PROTEIN (ANTIBODY M3C65 (LIGHT CHAIN)) COMBINED LIGHT AND HEAVY CHAIN VIA (G4S)3 LINKER FV (SINGLE CHAIN) 10090
443 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
444 4NC0 2 B A26.8 VHH 9844
445 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
446 1OCW 2 L IMMUNOGLOBULIN E FV REGION, RESIDUES 1-120 10090
447 1IGM 1 L IGM-KAPPA POT FV (LIGHT CHAIN) 9606
448 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
449 5GS1 1 A, M, O, Q light chain 9606
450 5GS1 2 B, N, P, R heavy chain 9606
451 5F7Y 3 C, D Nanobody Nb-ER19 9844
452 2DQG 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
453 2DQG 2 H Ig VH,anti-lysozyme 10090
454 5IMO 1 B Nanobody 9835
455 5U65 1 A, B VHH-5 9838
456 2PXY 1 A T cell receptor alpha chain 10090
457 3BDX 1 A, B, C Amyloid lambda 6 light chain variable region PIP (fragment) Residues 1-111 9606
458 4TYU 1 A, B Single Domain Antibody 9844
459 43CA 1 A, C, E, G PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN)) FV 10090
460 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
461 2DQH 1 L lysozyme binding Ig kappa chain V23-J2 region 10090
462 2DQH 2 H Ig VH,anti-lysozyme 10090
463 4AQ1 2 B, D NBKB6 VHH 9844
464 2Q1E 1 A, B, C, D Amyloidogenic immunoglobulin light chain protein AL-09 9606
465 4EIG 2 B CA1698 camel antibody fragment 9844
466 3EHB 3 C FV fragment Chain H 10090
467 3EHB 4 D FV fragment Chain L 10090
468 3HB3 3 C ANTIBODY FV FRAGMENT 10090
469 3HB3 4 D ANTIBODY FV FRAGMENT 10090
470 4FFY 1 L DENV1-E111 single chain variable fragment (light chain) 10090
471 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
472 4N1E 1 A, B, C, D, E, F, G, H immunoglobulin variable light chain domain 9606
473 2X89 1 A, B, C ANTIBODY 9838
474 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
475 5O04 2 E, F Nanobody (VHH) Nano-26 30538
476 5O04 3 C, D Nanobody (VHH) Nano-85 30538
477 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
478 5LBS 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 SCFV fragment, light chain 9606
479 3P9W 2 B, D, F, H human VEGF 9606
480 1AP2 1 A, C MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
481 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
482 5F8R 2 C, D Nanobody Nb-ER19 9844
483 1IC4 1 L LYSOZYME BINDING IG KAPPA CHAIN 10090
484 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
485 4OCL 3 C, F Nb1 9844
486 3CDY 1 A, B IMMUNOGLOBULIN LIGHT CHAIN 9606
487 4RAV 1 B, D Single-chain Fv, VL 9606
488 4RAV 2 A, C single-chain Fv, VH 9606
489 5LWY 2 H V REGION HEAVY CHAIN 10090
490 5LWY 3 L V REGION LIGHT CHAIN 10090
491 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
492 1KB9 11 K LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
493 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
494 4X4X 2 B, D Human Variable Light Chain of Herceptin 9606
495 2Z8V 2 C, D New antigen receptor variable domain 168098
496 4IOS 2 D, E, F, G Llama nanobody 11 9844
497 2W0K 1 A, B V1-22 PROTEIN 9606
498 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
499 2BFV 1 L FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
500 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
501 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
502 2IBZ 11 Y Variable Light chain of antibody fragment 10090
503 4K3H 1 A, B, C, D, E, F, G, H Immunoglobulin lambda variable domain L5(L89S) 9606
504 4C57 2 C, D NANOBODY 9844
505 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606 3.4.19.13 | Details
506 2Z8W 2 C, D New antigen receptor variable domain 168098
507 4OCN 3 C, F Nb1 9844
508 4GRW 3 E, G Nanobody 124C4 9844
509 4GRW 4 F, J Nanobody 37D5 9844
510 4GRW 5 H, I Nanobody 22E11 9844
511 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
512 4NC2 2 B B39 VHH 9844
513 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
514 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
515 2OI9 2 B T cell receptor alpha chain 10090
516 4HGM 1 A Shark V-NAR 7797
517 3BD4 1 A, B catalytic antibody 10090
518 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
519 1WT5 2 C, D ANTI EGFR ANTIBODY FV REGION VL fragment 9606
520 1JHL 1 L IGG1-KAPPA D11.15 FV (LIGHT CHAIN) 10090
521 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
522 5F9A 2 C Nanobody Nb-ER19 9844
523 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
524 4LLV 2 B, D, F, L 4E10 Fv light chain 9606
525 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
526 4LAR 2 L Single light chain variable fragment Light Chain 10090
527 5CBA 1 A, C 3b4 heavy chain 9606
528 5CBA 2 B, D 3b4 light chain 9606
529 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
530 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
531 1A14 3 L NC10 FV (LIGHT CHAIN) VL DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
532 1C08 1 A ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VL FRAGMENT 10090
533 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
534 2OTW 1 A, C Fv light chain avriable domain VL 10090
535 2OTW 2 B, D Fv heavy chain variable domain VH 10090
536 3STB 1 A, B single domain antibody VHH 9844
537 2YSS 1 A ANTI-LYSOZYME ANTIBODY FV REGION VL FRAGMENT 9606
538 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
539 4W6W 2 B NbFedF6 9844
540 5JA8 2 B, D, F, H Nanobody 2 9844
541 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
542 2YBR 2 B, E, H SINGLE CHAIN ANTIBODY FRAGMENT 9004G LIGHT CHAIN, RESIDUES 118-263 9606
543 2I26 1 N, O, P New Antigen Receptor Ancestral variable domain 7801
544 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
545 2BJM 2 L IGE SPE7 LIGHT CHAIN LIGHT CHAIN, RESIDUES 1-110 10090
546 2AP2 1 A, C PROTEIN (ANTIBODY (LIGHT CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
547 2AP2 2 B, D PROTEIN (ANTIBODY (HEAVY CHAIN)) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER THE SEQUENCE OF THE SINGLE CHAIN IS MKKTAIAIAVALAGFATVAQAVFVR (SIGNAL SEQUENCE) DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAS TRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP (LIGHT CHAINS A AND C) GGGGSGGGGSGKSGGGG (LINKER) EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNT KYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTT VTVPSG (HEAVY CHAINS B AND D) SEQKLISEEDLNHHHHH (C-MYC TAG + 5XHIS TAG) THE SIGNAL SEQUENCE WAS TO BE CLEAVED AFTER RESIDUE 0 FOR CHAINS A AND C. HOWEVER, ELECTRON DENSITY WAS PRESENT FOR RESIDUES -2, -1, AND 0. THE AUTHORS EXPECT THE OTHER RESIDUES OF THE SIGNAL SEQUENCE TO HAVE BEEN CLEAVED. AS FAR AS THE AUTHORS KNOW, THE LINKER IS NOT CLEAVED. ONLY SPARSE DENSITY COULD BE SEEN AND THEREFORE THE LINKER WAS EXCLUDED FROM THE DEPOSITED MODEL. THE C-MYC TAG AND HIS TAG WERE NOT ENZYMATICALLY CLEAVED. FV 10090
548 1P4B 1 L Antibody Variable light chain 10090
549 1P4B 2 H Antibody Variable heavy chain 10090
550 5O0W 2 E, F, G, H Nb474 30538
551 4Y5V 1 A, D, G diabody 305 VH domain 9606
552 4Y5V 2 B, E, H Diabody 305 VL domain 9606
553 1I9E 1 A CYTOTOXIC TCELL VALPHA DOMAIN N-TERMINAL DOMAIN OF ALPHA CHAIN 10090
554 1DQL 1 L IGM MEZ IMMUNOGLOBULIN LIGHT CHAIN VARIABLE DOMAIN FRAGMENT 9606
555 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
556 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
557 3V0A 3 C Llama antibody F12 9844
558 2Z35 1 A T-cell receptor alpha-chain 10090
559 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
560 3K80 1 A, B Antibody 9844
561 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
562 5F8Q 2 C, D Nanobody Nb-ER19 9844
563 4U05 1 A, B Single Domain Antibody 9844
564 5F9D 2 C Nanobody Nb-ER19 9844
565 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
566 4X4Y 2 B, D Human Variable Light Chain of Herceptin 9606
567 4LGP 2 B, D VHH1 camelid nanobody 30538
568 2P48 2 B ANTIBODY CAB-RN05 9838
569 5VXK 1 B single-domain antibody JMK-H2 30538
570 5F7M 2 C, D Nanobody Nb-ER19 9844
571 1VER 1 A New Antigen Receptor variable domain 168098
572 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
573 5F7W 2 C, D Nanobody Nb-ER19 9844
574 4YQX 1 H, N JES6-1 VH domain 10116
575 4YQX 2 L, O JES6-1 VL domain 10116
576 1FO0 4 A PROTEIN (BM3.3 T CELL RECEPTOR ALPHA-CHAIN) FV FRAGMENT, VARIABLE DOMAIN 10090
577 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
578 1EZV 11 Y LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
579 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
580 3U6R 2 B, L Antibody 1:7 (Light chain) 9606
581 1U3H 1 A, E T-cell receptor alpha-chain V2.3-J39-C 10090
582 1KTR 1 L Anti-his tag antibody 3d5 variable light chain 10090
583 1KTR 3 H Anti-his tag antibody 3d5 variable heavy chain 10090
584 2YWY 1 A, B, C, D new antigen receptor variable domain 168098
585 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
586 1NMC 3 C, L SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
587 1KB5 1 A KB5-C20 T-CELL ANTIGEN RECEPTOR 24 RESIDUE LINK BETWEEN VALPHA C-TERMINUS AND VBETA N-TERMINUS FV FRAGMENT, VARIABLE DOMAIN 10090
588 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
589 4NC1 2 C, D A20.1 VHH 9844
590 4NC1 3 E, F A26.8 VHH 9844
591 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
592 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
593 2DQF 1 A, D lysozyme binding Ig kappa chain V23-J2 region 10090
594 2DQF 2 B, E Ig VH,anti-lysozyme 10090
595 1B88 1 A, B T CELL RECEPTOR V-ALPHA DOMAIN V-ALPHA DOMAIN 10090
596 5E7F 1 A, B, C nanobody L06 9838
597 2P46 2 B, D ANTIBODY CAB-RN05 9838
598 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
599 3CXH 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT 10090
600 2E7L 1 A, B Cytotoxic Tcell receptor UNP RESIDUES 21-132 10090
601 5LHP 2 B Camelid-Derived Antibody Fragment 30538
602 2ICW 5 I, K T-cell receptor alpha chain V residues 21-131 10090
603 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
604 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
605 1P84 11 K Light Chain (Vl) Of Fv-Fragment 10090
606 5SV4 1 A, B Single Domain Antibody A3C8 9844
607 4LGS 2 B Camelid nanobody (VHH4) 30538
608 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
609 2XTJ 2 B FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
610 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
611 5CBE 1 A, C E10 heavy chain 9606
612 5CBE 2 B, D E10 light chain 9606
613 2P47 2 B ANTIBODY CAB-RN05 9838
614 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
615 3WXW 2 H V region heavy chain 10090
616 3WXW 3 L V region light chain 10090
617 3K3Q 1 A llama Aa1 VHH domain 9844
618 1F6L 1 L ANTI-FERRITIN IMMUNOGLOBULIN LIGHT CHAIN VARIABLE LIGHT CHAIN 9606
619 3LRH 1 A, C, E, G, I, K, M, O anti-huntingtin VL domain anti-huntingtin VL domain 9606
620 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
621 1AR1 3 C ANTIBODY FV FRAGMENT 10090
622 1AR1 4 D ANTIBODY FV FRAGMENT 10090
623 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
624 1BVK 1 A, D HULYS11 FV 9606
625 1BVK 2 B, E HULYS11 FV 9606
626 5FV1 1 L, M VK DOMAIN ANTIBODY VK DOMAIN ANTIBODY, RESIDUES 1-108 9606
627 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
628 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
629 2CJU 2 L NQ16-113.8 ANTI-PHOX ANTIBODY 10090
630 5HVF 2 B VHH-i83 30538
631 1P4I 1 L ANTIBODY VARIABLE LIGHT CHAIN 10090
632 1P4I 2 H antibody variable heavy chain 10090
633 4PGJ 1 A, C Human heavy chain domain antibody 9606
634 2LVE 1 A RLEN KAPPA-IV LIGHT CHAIN DIMER 9606
635 4KDT 1 A, B Nanobody24 9835
636 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
637 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
638 2VH5 2 L ANTI-RAS FV LIGHT CHAIN 9606
639 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
640 5MJE 2 B Nanobody 8 9844
641 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
642 3LH2 3 L, M, N, O Fv 4E10 light chain 9606
643 3OGO 2 E, F, G, H GFP-nanobody 9838
644 4C59 2 B NANOBODY 9844
645 5VXL 2 B single-domain antibody JPS-G3 30538
646 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
647 1OAZ 3 L, N IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
648 4DK6 1 A, B single domain antibody VHH 9844
649 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
650 1CL7 2 H PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)) FAB 10090
651 5F7L 2 B, D Nanobody Nb-ER14 9844
652 1KJ2 4 A, D KB5-C20 T-Cell receptor alpha-chain Fv fragment , variable domain 10090
653 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
654 1OAY 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
655 5HVG 2 B, D VHH-a204 30538
656 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
657 4LAQ 2 L Single light chain variable fragment Light Chain 10090
658 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606 3.4.19.13 | Details
659 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
660 5HVH 2 B VHH-a204 30538
661 5HVH 3 C VHH-i83 30538
662 4XT1 3 C nanobody 7 30538
663 5LXG 2 H V REGION HEAVY CHAIN 10090
664 5LXG 3 L V REGION LIGHT CHAIN 10090
665 5HM1 1 A, B, C lama VHH antibody 2E7 9844
666 5FUC 3 E, V VHH6 9838
667 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
668 4RZC 2 B, D, F, L Fv M6P-1 heavy chain 9986
669 3H3P 1 H, I Fv 4E10 heavy chain 9606
670 3H3P 2 L, M Fv 4E10 light chain 9606
671 5O2U 2 B, D VHH 59H10 9844
672 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
673 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
674 3NN8 2 B, E, F, H Engineered scFv, light chain 10090
675 5OMN 2 C Nanobody (VHH) Nano-27 30538
676 4KRP 2 B Nanobody/VHH domain 9G8 9844
677 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
678 1OAX 2 L, M, N, O IMMUNOGLOBULIN E FV REGION, RESIDUES 1-110 10090
679 4FHB 2 D Nb179 9844
680 4DK3 1 A, B single domain antibody VHH 9844
681 4KRL 1 B Nanobody/VHH domain 7D12 9844
682 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
683 4V1D 2 B SINGLE CHAIN ANTIBODY FRAGMENT LR, LIGHT CHAIN 9606
684 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
685 4V1D 5 E SINGLE CHAIN ANTIBODY FRAGMENT RU1, LIGHT CHAIN 9606
686 2Z31 1 A T-cell receptor alpha-chain 10090
687 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
688 1NMA 2 L FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
689 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
690 1NAM 1 A BM3.3 T Cell Receptor alpha-Chain Fv Fragment, Variable Domain 10090
691 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
692 4LDE 2 B Camelid Antibody Fragment 9844
693 4Y5Y 1 A, D diabody 330 VH domain 9606
694 4Y5Y 2 B, E diabody 330 VL domain 9606
695 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
696 1BVL 1 A, C HULYS11 FV 10090
697 1BVL 2 B, D HULYS11 FV 10090
698 3RJQ 2 B Llama VHH A12 9844
699 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
700 4UNT 1 A, B, C, D, E, F, G, H IG LAMBDA CHAIN V-II REGION MGC LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-110 9606
701 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
702 3AB0 3 C, F antibody ScFv fragment, light chain 10090
703 3LHP 1 H, I Fv 4E10 heavy chain 9606
704 3LHP 2 L, M Fv 4E10 light chain 9606
705 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
706 2BX5 1 A, B, C, D, E, F, G, H, I, J, K, L, M, N, O VD9 VKI LIGHT-CHAIN LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-107 9606
707 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
708 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
709 4KFZ 2 C, D Anti-LMO2 VH 9606 3.4.19.13 | Details
710 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
711 2UUD 2 K, L NQ10-1.12 ANTI-PHOX ANTIBODY 10090
712 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
713 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
714 4Y5X 2 B, E, H, K diabody 310 VH domain 9606
715 4YGA 2 B, D, F, H VHH-1B7 30538
716 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
717 4UT9 3 L, M, N, O BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, LIGHT CHAIN DOMAIN 9606
718 2A9N 1 L, M fluorescein-scfv light chain 9606
719 2A9N 2 H, I fluorescein-scfv heavy chain 9606
720 5XQY 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 Y96K mutant of REI VL 9606
721 5GS0 2 C, E light chain (anti-TLR3) 10090
722 5GS0 3 D, F heavy chain (anti-TLR3) 10090
723 5GS0 4 H, X heavy chain (anti-Lid) 10090
724 5GS0 5 L, Y light chain (anti-Lid) 10090
725 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
726 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
727 1KYO 11 K, V LIGHT CHAIN (VL) OF FV-FRAGMENT RESIDUES 1-107 10090
728 5GRJ 1 H avelumab H chain 9606
729 5GRJ 2 L avelumab L chain 9606
730 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
731 4NKD 2 B, D, F, H Engineered scFv light chain 10090
732 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
733 4KRO 2 B Nanobody/VHH domain EgA1 9844
734 3WXV 2 H V region heavy chain 10090
735 3WXV 3 L V region light chain 10090
736 1AR2 1 A REI VARIABLE REGION, LIGHT CHAIN 9606
737 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
738 4KV5 3 F, I, K, L light chain GC1009 scFv 9606
739 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
740 5TJW 2 K NP-specific inhibitory VHH 30538
741 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
742 1QLE 6 L LIGHT CHAIN ANTIBODY FV FRAGMENT 10090
743 4LDL 2 B Camelid Antibody Fragment 9844
744 3E3Q 3 C, D, I, M, R, V, Z, d T-cell receptor alpha chain V region PHDS58 10090
745 5XP1 1 A, B, C, D, E, F, G, H Immunoglobulin kappa variable 1D-33 UNP residues 22-117 9606
746 4LDO 2 B Camelid Antibody Fragment 9844
747 3SN6 5 N Camelid antibody VHH fragment 9844
748 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
749 4M8Q 1 A, H GEP1 Fv heavy chain 9606
750 4M8Q 2 B, L GEP1 Fv light chain UNP residues 21-129 9606
751 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
752 5C3L 4 D Nanobody Nb15 Nanobody 9838
753 5J3H 2 C mAb 83-7 Fab heavy chain 10090
754 5J3H 3 D mAb 83-7 Fab light chain 10090
755 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
756 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
757 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
758 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
759 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
760 4PIR 2 F, G, H, I, J VHH15 9844
761 4QKX 2 B R9 protein 9844
762 5JQH 2 C, D Nanobody60, Nb60 9844
763 4YBQ 2 C, E antibody Fv fragment light chain 10090
764 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
765 4PD4 10 J Igh protein 10090
766 4PD4 11 K Ig kappa chain V-V region HP 124E1 10090
767 5DA0 2 B Nanobody 9844
768 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
769 4R0L 3 B, L Antibody 1C6 Light chain UNP residues 20-137 10090
770 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
771 4ODX 2 A, H GEP7 Fv heavy chain 9606
772 4ODX 3 B, L GEP7 Fv light chain 9606
773 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
774 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
775 3E2H 3 B T-cell receptor alpha chain V region PHDS58 10090
776 4H1L 4 G, I Ani2.3 TCR A chain 562
777 1RVF 5 L FAB 17-IA 10090
778 1RVF 6 H FAB 17-IA 10090
779 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
780 5JZ7 3 D, I, K, L MEDI578 scFv, light chain 9606
781 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
782 4MQS 2 B Nanobody 9-8 9844
783 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
784 5DHY 2 B, L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
785 1QFW 3 L ANTIBODY (ANTI ALPHA SUBUNIT) (LIGHT CHAIN) FV 10090
786 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
787 1QFW 5 M ANTIBODY (ANTI BETA SUBUNIT) (LIGHT CHAIN) FV 10090
788 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
789 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
790 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
791 4OGA 4 D monoclonal antibody fab 83-7 fragment - light chain 10090
792 4MQT 2 B Nanobody 9-8 9844
793 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
794 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
795 4NKM 2 B, D, F, H Engineered scFv light chain 10090
796 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
797 3W11 4 D monoclonal antibody fab 83-7 fragment - light chain 10090
798 4NKO 1 A, C, E Engineered scFv light chain 10090
799 4NKO 2 B, D, F Engineered scFv heavy chain 10090
800 5EUL 4 V AYC08 30538
801 5GXB 2 B nanobody 30538
802 5NBD 2 C Nanobody 9844
803 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
804 3W13 3 D monoclonal antibody fab 83-7 fragment - light chain 10090
805 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
806 3W12 3 D monoclonal antibody fab 83-7 fragment - light chain 10090
807 5H8O 1 A VHH nanobody 9844
808 4KSD 2 B R2 protein 9844
809 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
810 5DHZ 2 L Anti-Rev Antibody Fab single-chain variable fragment, light chain 9986
811 2A0L 2 C, E 33H1 Fv fragment Fv fragment,light chain 10090
812 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
813 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
814 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
815 5TD8 5 E nanobody 30538
816 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
817 5Y0A 3 E, G, L variable region of Fab ZKA190 light chain 9606
818 5XS7 1 L Light chain of Fab 1D5 10090
819 5XS7 2 H Heavy chain of Fab 1D5 10090
820 5W3L 5 E C5 antibody variable heavy domain 10090
821 5W3L 6 G C5 antibody variable light domain 10090
822 5W3M 1 E C5 antibody variable heavy domain 10090
823 5W3M 2 G C5 antibody variable light domain 10090
824 5W3O 1 D C5 antibody variable heavy domain 10090
825 5W3O 2 E C5 antibody variable light domain 10090
826 5W3E 1 E C5 antibody variable heavy domain 10090
827 5W3E 2 G C5 antibody variable light domain 10090
828 5VAI 6 N nanobody 35 9844
829 5UZ7 4 N NANOBODY 35 9844
830 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
831 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
832 5TR1 3 L, M Monoclonal antibody, Fab fragment, light chain 10090
833 5TQQ 2 L, M Monoclonal antibody, Fab fragment, light chain 10090
834 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
835 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
836 5H32 3 H, L, M C10 IgG light chain variable region 9606
837 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
838 5H37 4 H, L, M C10 IgG light chain variable region 9606
839 5H30 3 G, I, K IgG C10 heavy chain 9606
840 5H30 4 H, L, M IgG C10 light chain 9606
841 5KWL 4 7 VHH 10E 9838
842 5KTZ 4 7 VHH 12B 9838
843 5KU0 4 7 VHH 17B 9838
844 5KU2 4 7 VHH 7A 9838
845 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
846 5KEL 4 L, T, U c2G4 variable Fab domain light chain 9606
847 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
848 5KEL 6 D, N, O c13C6 variable Fab domain light chain 9606
849 5KEM 1 C, H BDBV91 variable Fab domain light chain 9606
850 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
851 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
852 5KEM 4 E, J c13C6 variable Fab domain light chain 9606
853 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
854 5KEN 4 D, H, O c4G7 variable Fab domain light chain 9606
855 5KEN 5 I, P c13C6 variable Fab domain light chain 9606
856 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
857 3JCX 2 H Fab E heavy chain 10116
858 3JCX 3 L Fab E light chain 10116
859 5FOJ 1 A NANOBODY 9838
860 3JBC 5 7 nanobody VHH PVSP29F 9838
861 3JBD 5 7 nanobody VHH PVSP6A 9838
862 3JBE 5 7 nanobody VHH PVSS8A 9838
863 3JBF 5 7 nanobody VHH PVSP19B 9838
864 3JBG 5 7 nanobody VHH PVSS21E 9838
865 3JBA 1 L H16.U4 antibody light chain Fab variable domain 10090
866 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
867 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
868 3JAU 3 L Light chain of Fab fragment variable region of antibody D5 10090
869 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
870 5A1Z 4 H, J, L ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - LIGHT CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
871 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
872 4UIF 4 H, J, L ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - LIGHT CHAIN 9606
873 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
874 4UIH 3 E, G ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -LIGHT CHAIN 9606
875 4UDF 3 10, 14, 18, 1C, 1G, 1K, 1O, 1S, 1W, 20, 24, 28, 2C, 2G, 2K, 2O, 2S, 2W, 30, 34, 38, 3C, 3G, 3K, 3O, 3S, 3W, 40, 44, 48, 4C, 4G, 4K, 4O, 4S, 4W, 50, 54, 58, 5C, 5G, 5K, 5O, 5S, 5W, 60, 64, 68, 6C, 6G, 6K, 6O, 6S, 6W, 7C, 7G, 7K, 7O, 7S, 7W HUMAN MONOCLONAL ANTIBODY 9606
876 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
877 3J8Z 2 J, K, L, M H16.1A light chain variable domain Fab 10090
878 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
879 3J8V 2 J, K, L, M H16.14J light chain variable domain Fab 10090
880 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
881 3J8W 1 J, K, L, M H263.A2 light chain variable domain Fab 10090
882 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
883 3J7E 1 A, C, E, L H16.V5 Fab light chain variable domain 10090
884 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
885 3J6U 3 H Fab 5J7 heavy chain variable region 9606
886 3J6U 4 L Fab 5J7 light chain variable region 9606
887 2MMX 1 A V1-22 protein 9606
888 2MKW 1 A V1-22 protein 9606
889 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
890 4CKD 3 L, M, N, O SCFV13R4 ANTIBODY FV LIGHT CHAIN 10090
891 2KQM 1 A, B Ig kappa chain V-I region AU Immunoglobulin kappa light chain 9606
892 2KQN 1 A, B Ig kappa chain V-I region AU Immunoglobulin kappa light chain 9606
893 3IY1 1 A Fab B, light chain antibody B fragment 10116
894 3IY1 2 B Fab B, heavy chain 10116
895 3IY2 1 A Antibody 6, light chain fragment of antibody 6 10090
896 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
897 3IY3 1 A antibody fragment from neutralizing antibody 8 (light chain) FAb 8 10090
898 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
899 3IY4 1 A fragment of neutralizing antibody 15 (light chain) fragment of neutralizing antibody 15 10090
900 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
901 3IY5 1 A antibody fragment IGG2A (light chain) Fab 10090
902 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
903 3IY6 1 A fragment from neutralizing antibody E (light chain) FAb E 10116
904 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
905 3IY7 1 A fragment from neutralizing antibody F (light chain) FAb F 10116
906 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
907 3IY0 1 L Fab 14, light domain Fab14 10090
908 3IY0 2 H Fab 14, heavy domain 10090
909 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
910 1G9E 1 A H14 9844
911 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
912 1QNZ 2 L 0.5B ANTIBODY (LIGHT CHAIN) FV 10090
913 1VHP 1 A VH-P8 9606
914 1MAJ 1 A IGG2A-KAPPA 26-10 FV (LIGHT CHAIN) 10090
915 1MAK 1 A IGG2A-KAPPA 26-10 FV (LIGHT CHAIN) 10090
916 1REI 1 A, B BENCE-JONES PROTEIN REI (LIGHT CHAIN) 9606