Sequence Similarity Clusters for the Entities in PDB 1KNU

Entity #1 | Chains: A,B
PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA protein, length: 274 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 112 148 110
95 % 129 171 120 Flexibility: Low
Max RMSD: 3.6, Avg RMSD: 1.6
PDBFlex
90 % 129 171 123
70 % 129 171 141
50 % 173 230 109
40 % 173 230 129
30 % 998 1284 8

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4PF3 1 A Mineralocorticoid receptor UNP residues 716-988 9606
2 1YMT 1 A Steroidogenic factor 1 mSF-1 LBD (residues 219-462) 10090
3 1FCY 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH CD564, RESIDUE 564 LIGAND BINDING DOMAIN 9606
4 3VHV 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 727-984 9606
5 1FD0 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH SR11254, RESIDUE 254 LIGAND BINDING DOMAIN 9606
6 1FCZ 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH BMS181156, RESIDUE 156 LIGAND BINDING DOMAIN 9606
7 3B0T 1 A Vitamin D3 receptor vitamin D receptor binding domain 9606
8 1FCX 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH BMS184394, RESIDUE 184 LIGAND BINDING DOMAIN 9606
9 3WFG 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
10 4OHA 1 A Androgen receptor ligand binding doamin 9606
11 3A40 1 X Vitamin D3 receptor Ligand Binding Domain, UNP residues 118-427 9606
12 5V8Q 1 A Androgen receptor UNP residues 140-388 9606
13 1T7R 1 A Androgen receptor ligand binding domain 9598
14 3AZ3 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
15 1SR7 1 A, B Progesterone receptor Ligand binding domain 9606
16 3CJW 1 A COUP transcription factor 2 ligand binding domain, residues 173-412 9606
17 5U3Q 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
18 1SQN 1 A, B progesterone receptor residues 676-933, ligand binding domain 9606
19 1IE9 1 A VITAMIN D3 RECEPTOR 9606
20 3OLL 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
21 5DXE 1 A, B Estrogen receptor 9606
22 3VTC 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
23 3MNP 1 A Glucocorticoid receptor UNP residues 527-783 10090
24 3MNO 1 A Glucocorticoid receptor UNP residues 527-783 10090
25 3U9Q 1 A Peroxisome proliferator-activated receptor gamma Ligand Binding Domain, UNP residues 236-504 9606
26 3AZ1 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
27 1NQ7 1 A NUCLEAR RECEPTOR ROR-BETA LIGAND-BINDING DOMAIN 10116
28 3L3X 1 A Androgen receptor 9606
29 3UUD 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
30 3UUD 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
31 2E2R 1 A Estrogen-related receptor gamma ligand binding domain, residues 232-459 9606
32 5UFW 1 A, B Estrogen receptor 9606
33 5UFX 1 A, B Estrogen receptor 9606
34 1IE8 1 A VITAMIN D3 RECEPTOR 9606
35 1YP0 1 A nuclear receptor subfamily 5, group A, member 1 ligand binding domain (Residues: 223-461) 10090
36 3ZR7 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 9606
37 1XPC 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
38 5KCT 1 A, B Estrogen receptor ligand-binding domain 9606
39 5W9D 1 A, B Estrogen receptor 9606
40 5APH 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
41 1T7M 1 A Androgen receptor ligand binding domain 9598
42 1T7F 1 A Androgen receptor ligand binding domain 9598
43 2PNU 1 A Androgen receptor ligand binding domain 9606
44 3VT7 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
45 2AX6 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
46 1EXA 1 A RETINOIC ACID RECEPTOR GAMMA-2 LIGAND BINDING DOMAIN 9606
47 1EXX 1 A RETINOIC ACID RECEPTOR GAMMA-2 LIGAND BINDING DOMAIN 9606
48 2IOG 1 A Estrogen receptor Steroid-binding region, residues 306-554 9606
49 5U42 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
50 5MKU 1 A Retinoic acid receptor RXR-alpha 9606
51 3TKC 1 A Vitamin D3 receptor 9606
52 1N83 1 A Nuclear receptor ROR-alpha Ligand Binding Domain, residues 304-556 9606
53 1XP6 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
54 2AM9 1 A Androgen receptor ligand binding domain 9606
55 4QE6 1 A Bile acid receptor unp residues 258-486 9606
56 3OGT 1 A Vitamin D3 receptor 9606
57 5NTW 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
58 2GPU 1 A Estrogen-related receptor gamma Ligand Binding Domain (Residues 229-458) 9606
59 3B1M 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
60 5U3Z 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
61 1T7T 1 A Androgen receptor ligand binding domain 9598
62 5U3T 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
63 4WLB 1 A, B Nuclear receptor ROR-gamma ROR-gamma ligand binding domain 9606
64 2QXS 1 A, B Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
65 3V49 1 A Androgen receptor unp residues 654-919 9606
66 3A3Z 1 X Vitamin D3 receptor Ligand Binding Domain, UNP residues 118-427 9606
67 3V9T 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
68 2QZO 1 A Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
69 2QZO 2 B Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
70 5Q0I 1 A Bile acid receptor UNP residues 258-486 9606
71 3P8X 1 A Vitamin D3 receptor Ligand binding domain 9606
72 3V9V 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
73 4ONI 1 A, B Nuclear receptor subfamily 5 group A member 2 Ligand Binding Domain, UNP residues 291-541 9606
74 1G2N 1 A ULTRASPIRACLE PROTEIN LIGAND BINDING DOMAIN 7102
75 3AZ2 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
76 5M24 1 A Retinoic acid receptor gamma UNP residues 178-423 9606
77 5G42 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
78 5Y2T 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
79 5NTP 1 A Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
80 3B66 1 A Androgen receptor residues 671-919 9606
81 2ZKC 1 A Estrogen-related receptor gamma ligand binding domain, UNP residues 222-459 9606
82 3ILZ 1 A Thyroid hormone receptor, alpha isoform 1 variant 9606
83 4CI5 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 206-477 9606
84 6G07 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
85 2AAX 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
86 3VT3 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
87 4ZNV 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
88 3L0L 1 A, B Nuclear receptor ROR-gamma RORgamma 9606
89 2H79 1 A THRA protein 9606
90 3PLZ 1 A, B FTZ-F1 related protein UNP residues 300-541 9606
91 5Y7X 1 A, B Peroxisome proliferator-activated receptor delta UNP residues 171-441 9606
92 2AX9 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
93 4PLD 1 A Nuclear receptor subfamily 5 group A member 2 UNP residues 301-541 9606
94 5G46 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
95 6CHZ 1 A Estrogen receptor 9606
96 4OIV 1 A, B Bile acid receptor UNP RESIDUES 258-483 9606
97 5FQV 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
98 5WGD 1 A, B Estrogen receptor 9606
99 2AMB 1 A Androgen receptor ligand binding domain 9606
100 5KD9 1 A, B Estrogen receptor ligand-binding domain 9606
101 2ZMI 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
102 2AX8 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
103 1XP1 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
104 2Q7K 1 A Androgen receptor 9606
105 5M96 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain, UNP residues 263-491 9606
106 4TV1 1 A Estrogen receptor Residues 302-552 9606
107 4TV1 2 B Estrogen receptor Residues 302-552 9606
108 5HJS 1 A, B Oxysterols receptor LXR-alpha 9606
109 3ZRB 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 678-933 9606
110 5KCD 1 A, B Estrogen receptor ligand-binding domain 9606
111 2J7Y 1 A ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 255-509 10116
112 2QSE 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
113 5DXG 1 A, B Estrogen receptor 9606
114 2W8Y 1 A, B PROGESTERONE RECEPTOR PR LBD, RESIDUES 678-933 9606
115 1XP9 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
116 5C4T 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
117 2HB7 1 A Vitamin D3 receptor Ligand binding domain 9606
118 5U2D 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
119 4LNW 1 A Thyroid hormone receptor alpha 9606
120 4RWV 1 A Nuclear receptor subfamily 5 group A member 2 LIGAND BINDING DOMAIN (UNP residues 294-551) 9606
121 1A28 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN 9606
122 3W0H 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-164, 212-420 10116
123 1DB1 1 A VITAMIN D NUCLEAR RECEPTOR LIGAND BINDING DOMAIN 9606
124 3CS6 1 A Vitamin D3 receptor UNP residues 118-427 9606
125 5U3W 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
126 3WT5 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
127 5TN4 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
128 3W0A 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
129 4G2I 1 A Vitamin D3 receptor unp residues 118-417 9606
130 2Q7I 1 A Androgen receptor 9606
131 4MG8 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
132 4MG8 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
133 2P1T 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
134 3MNE 1 A Glucocorticoid receptor UNP residues 527-783 10090
135 3VI8 1 A Peroxisome proliferator-activated receptor alpha Ligand binding domain 9606
136 4MGA 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
137 4MGA 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
138 3KMR 1 A Retinoic acid receptor alpha ligand binding domain (UNP RESIDUE 176-421) 9606
139 4PLE 1 A, C, E, G Nuclear receptor subfamily 5 group A member 2 UNP residues 301-541 9606
140 2B1Z 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
141 5W9C 1 A, B, C, D Estrogen receptor 9606
142 1T79 1 A Androgen receptor ligand binding domain 9598
143 5NIB 1 A Nuclear receptor ROR-gamma 9606
144 2P54 1 A Peroxisome proliferator-activated receptor alpha PPAR alpha 9606
145 5GT4 1 A Vitamin D3 receptor UNP RESIDUES 118-164,216-423 9606
146 3AUN 1 A Vitamin D3 receptor ligand binding domain 10116
147 2P15 1 A, B Estrogen receptor Ligand Binding Domain (residues 298-554) 9606
148 5G44 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
149 5Q13 1 A, C Bile acid receptor 9606
150 3RLL 1 A Androgen receptor Ligand binding domain residues 671-917 9606
151 3A78 1 A Vitamin D3 receptor Ligand Binding Domain 9606
152 5Y2O 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
153 2ZBS 1 A Estrogen-related receptor gamma ligand binding domain, residues 222-459 9606
154 5Q1E 1 A Bile acid receptor 9606
155 4WQP 1 A, B Nuclear receptor ROR-gamma ROR-gamma ligand binding domain 9606
156 4S15 1 A, B Nuclear receptor ROR-alpha ligand-binding domain 9606
157 4DOR 1 A, B Nuclear receptor subfamily 5 group A member 2 UNP residues 290-541 9606
158 5AAU 1 A, B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
159 2B1V 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
160 1T65 1 A Androgen receptor AR Ligand Binding Domain 669-919 9606
161 4OEY 1 A Androgen receptor ligand binding domain 9606
162 2YJA 2 B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 299-551 9606
163 3L03 1 A, B Estrogen receptor UNP residues 298-550 9606
164 5TLT 1 A, B Estrogen receptor ligand-binding domain 9606
165 2PIT 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
166 5DZI 1 A, B Estrogen receptor ligand-binding domain 9606
167 4TUZ 1 A Estrogen receptor Residues 302-552 9606
168 4TUZ 2 B Estrogen receptor Residues 302-552 9606
169 5KCE 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
170 4ZSH 1 A Retinoic acid receptor RXR-alpha Ligand binding domain residues 223 - 462 9606
171 2AXA 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
172 1XOW 1 A androgen receptor inhibited by r1881 ligand binding domain 9606
173 4PXM 1 A, B Estrogen receptor D538G 9606
174 2Q7J 1 A Androgen receptor 9606
175 5K13 1 A Retinoic acid receptor alpha UNP residues 176-421 9606
176 2AB2 1 A, B Mineralocorticoid receptor MR Ligand Binding Domain 9606
177 4IWF 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
178 5Q0K 1 A Bile acid receptor UNP residues 258-486 9606
179 4UDD 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, UNP RESIDUES 500-777 9606
180 5U3V 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
181 3V4A 1 A Androgen receptor unp residues 671-919 9606
182 1QKM 1 A ESTROGEN RECEPTOR BETA COMPLEXED WITH THE PHYTO-OESTROGEN GENISTEIN LIGAND-BINDING DOMAIN 9606
183 4PPS 1 A, B Estrogen receptor ligand-binding domain (UNP residues 305-548) 9606
184 2HAM 1 A Vitamin D3 receptor Ligand binding domain 9606
185 5L11 1 A Nuclear receptor subfamily 5 group A member 2 unp residues 299-541 9606
186 5B41 1 A Vitamin D3 receptor deletion mutant, residues 165-211 UNP RESIDUES 116-164, 212-423 10116
187 6FZU 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
188 3X36 1 A Vitamin D3 receptor ligand binding domain (UNP residues 118-164, 216-427) 9606
189 5U43 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
190 2Q7L 1 A Androgen receptor 9606
191 1YIM 1 A Estrogen receptor LIGAND BINDING DOMAIN, residues 307-554 9606
192 1TXI 1 A Vitamin D receptor ligand binding domain 9606
193 5GTN 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
194 3E94 1 A Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
195 2HAR 1 A Vitamin D3 receptor Ligand binding domain 9606
196 5Q0O 1 A, C Bile acid receptor 9606
197 5HYK 1 A Peroxisome proliferator-activated receptor alpha 9606
198 1Z95 1 A Androgen Receptor LIGAND BINDING DOMAIN 9606
199 4ZNS 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
200 5KCW 1 A, B Estrogen receptor ligand-binding domain 9606
201 3RY9 1 A, B Ancestral Glucocorticoid Receptor 1 ligand binding domain 32630
202 5Q0P 1 A, C Bile acid receptor 9606
203 4OEZ 1 A Androgen receptor ligand binding domain 9606
204 1MZN 1 A, C, E, G RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
205 3WGP 1 A Vitamin D3 receptor UNP residues 120-423 9606
206 2XKW 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 204-477 9606
207 4MGB 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
208 4MGB 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
209 3ET3 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
210 2GPO 1 A Estrogen-related receptor gamma Ligand Binding Domain (Residues 229-458) 9606
211 4LNX 1 A Thyroid hormone receptor alpha UNP P10827 residues 148-370, UNP Q6LDR0 residues 36-75 9606
212 5FQS 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
213 5Q0U 1 A, C Bile acid receptor 9606
214 6ESN 1 A Nuclear receptor ROR-gamma 9606
215 4ZNT 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
216 5MJ5 1 A Retinoic acid receptor RXR-alpha 9606
217 3W0Y 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
218 4MGD 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
219 4MGD 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
220 4JYI 1 A, B Retinoic acid receptor beta Ligand binding domain, UNP residues 176-421 9606
221 6CHW 1 A Estrogen receptor 9606
222 5Q14 1 A, C Bile acid receptor 9606
223 2QA8 1 A Estrogen receptor Steroid-binding region, residues 298-554 9606
224 2QA8 2 B Estrogen receptor Steroid-binding region, residues 298-554 9606
225 5MK4 1 A, C Retinoic acid receptor RXR-alpha UNP residues 229-457 9606
226 4Y29 1 A Peroxisome proliferator-activated receptor gamma UNP residues 236-504 9606
227 3W0C 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
228 3JZB 1 A THRA protein UNP residues 148-410, Ligand Binding Domain 9606
229 1MV9 1 A RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
230 1MVC 1 A RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
231 5NTN 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
232 5E1C 1 A, B Estrogen receptor ligand-binding domain 9606
233 1ZGY 1 A Peroxisome proliferator activated receptor gamma PPARgamma Ligand Binding Domain 9606
234 5U46 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
235 3WJ5 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
236 3W0I 1 A Vitamin D3 Receptor LIGAND BINDING DOMAIN, UNP residues 121-159, 218-420 10116
237 3BEJ 1 A, B Bile acid receptor residues 249-486 9606
238 5U3R 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
239 3B5R 1 A Androgen receptor residues 671-919 9606
240 3G8O 1 A, B Progesterone receptor ligand binding domain 9606
241 2HAS 1 A Vitamin D3 receptor ligand binding domain 9606
242 5U3Y 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
243 5FQP 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP 307-554 9606
244 1OSH 1 A Bile acid receptor Ligand Binding Domain 9606
245 4IW6 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
246 5Q1D 1 A, C Bile acid receptor 9606
247 5U45 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
248 3OMK 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
249 4DM6 1 A, B Retinoic acid receptor beta unp residues 176-421 9606
250 2AX7 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
251 3OLF 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
252 5TN5 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
253 5DWE 1 A, B Estrogen receptor ligand-binding domain 9606
254 2Q1H 1 A AncCR 32644
255 4OKW 1 A Androgen receptor ligand binding doamin 9606
256 1ZUC 1 A, B Progesterone receptor 9606
257 4APU 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 514-769 9606
258 3W0J 1 A Vitamin D3 Receptor LIGAND BINDING DOMAIN, UNP residues 121-164, 212-420 10116
259 4ZN7 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
260 3LMP 1 A Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
261 5UC3 1 A, B Glucocorticoid receptor UNP residues 522-777 9606
262 5FQR 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
263 5Q0V 1 A, C Bile acid receptor 9606
264 5B5B 1 A, D Vitamin D3 receptor UNP RESIDUES 116-164, 212-423 10116
265 4RMD 1 A Retinoic acid receptor RXR-alpha ligand binding domain 228-458 9606
266 4MG9 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
267 4MG9 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
268 3WJ4 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
269 4X1F 1 A Nuclear receptor subfamily 1 group I member 2 UNP residues 130-434 9606
270 5Q0W 1 A Bile acid receptor 9606
271 2AA6 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
272 2PIP 1 L Androgen receptor Ligand-binding domain (residues 669-919) 9606
273 5VB3 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
274 3VRV 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
275 5AAV 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN 9606
276 5AAV 2 B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN 9606
277 4RZF 1 A, B Nuclear receptor subfamily 4 group A member 1 Nur77-LBD 9606
278 5U41 1 A, B Peroxisome proliferator-activated receptor delta UNP RESIDUES 131-402 9606
279 5Q0R 1 A Bile acid receptor 9606
280 3M7R 1 A Vitamin D3 receptor VDR, UNP residues 120-423 9606
281 3VT4 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
282 5Q12 1 A Bile acid receptor 9606
283 3CS4 1 A Vitamin D3 receptor UNP residues 118-427 9606
284 3B65 1 A Androgen receptor residues 671-919 9606
285 4Q0A 1 C Vitamin D3 receptor A Ligand binding domain 7955
286 5SYZ 1 A Nuclear receptor subfamily 5 group A member 2 9606
287 5Q1I 1 A Bile acid receptor 9606
288 5ACC 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
289 3ZRA 1 A, B PROGESTERONE RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 678-933 9606
290 3TKM 1 A Peroxisome proliferator-activated receptor delta LBD, UNP residues 171-441 9606
291 4ZNH 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
292 5Q18 1 A, C Bile acid receptor 9606
293 2AMA 1 A Androgen receptor ligand binding domain 9606
294 5XZF 1 A Vitamin D3 receptor UNP residues 116-423 10116
295 2HB8 1 A Vitamin D3 receptor Ligand binding domain 9606
296 3G0W 1 A Androgen receptor Ligand-binding domain 10116
297 2BJ4 1 A ESTROGEN RECEPTOR RESIDUES 305-533 (LIGAND-BINDING DOMAIN) 9606
298 2BJ4 2 B ESTROGEN RECEPTOR RESIDUES 305-533 (LIGAND-BINDING DOMAIN) 9606
299 5TM8 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
300 2ZL9 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
301 2FVJ 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, RESIDUES 207-477 9606
302 5JI0 1 A Retinoic acid receptor RXR-alpha 9606
303 5JI0 2 D Peroxisome proliferator-activated receptor gamma 9606
304 5TN1 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
305 5NTK 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
306 1L2I 1 A, B ESTROGEN RECEPTOR ligand-binding domain (residues 297-554) 9606
307 4DOS 1 A Nuclear receptor subfamily 5 group A member 2 Ligand Binding Domain, UNP residues 299-538 9606
308 5UNJ 1 A Nuclear receptor subfamily 5 group A member 2 unp residues 299-541 9606
309 1YUC 1 A, B Orphan nuclear receptor NR5A2 Ligand Binding Domain 9606
310 2AO6 1 A androgen receptor INHIBITED BY R1881 LIGAND BINDING DOMAIN 9606
311 5U3S 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
312 2POG 1 A, B Estrogen receptor ligand binding domain (residues 304-551) 9606
313 4OJB 1 A Androgen receptor ligand binding doamin 9606
314 1SJ0 1 A Estrogen receptor Ligand Binding Domain 9606
315 5TWO 1 A Peroxisome proliferator-activated receptor gamma lignad binding domain (UNP residues 234-505) 9606
316 5JMM 1 A Estrogen receptor 9606
317 5JMM 2 B Estrogen receptor 9606
318 5YSY 1 A Vitamin D3 receptor ligand binding domain 9606
319 3GZ9 1 A Peroxisome proliferator-activated receptor delta Ligand Binding Domain (residues 207-475) 9606
320 1GS4 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 670-917 9606
321 5FQT 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
322 3FLI 1 A Bile acid receptor Ligand Binding Domain 9606
323 4LTW 1 A Ancestral Steroid Receptor 2
324 5YT2 1 A Vitamin D3 receptor ligand binding domain 9606
325 2Q1V 1 A AncCR 32644
326 5U40 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
327 4UDA 1 A MINERALOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 735-984 9606
328 3RLJ 1 A Androgen receptor Ligand-binding domain residues 671-917 9606
329 5E0W 1 A, B Estrogen receptor ligand-binding domain 9606
330 5NU1 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
331 3OS8 1 A, B Estrogen receptor 9606
332 3OS8 2 C, D Estrogen receptor 9606
333 3L3Z 1 A Androgen receptor ligand binding domain 9606
334 5MX7 1 A1 Vitamin D3 receptor A UNP residues 156-453 7955
335 5XZH 1 A Vitamin D3 receptor UNP residues 116-423 10116
336 2QAB 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
337 3KBA 1 A, B Progesterone receptor Steroid-binding region: UNP residues 681-933 9606
338 5Q0J 1 A, C Bile acid receptor UNP residues 258-486 9606
339 2OZ7 1 A Androgen receptor residues 671-919 9606
340 1K4W 1 A Nuclear receptor ROR-beta ligand-binding domain 10116
341 5VB6 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
342 3KDU 1 A, B Peroxisome proliferator-activated receptor alpha Ligand-binding domain: UNP residues 196-468 9606
343 5K38 1 A, B Nuclear receptor ROR-gamma ligand binding domain 9606
344 6G05 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
345 5DXB 1 A Estrogen receptor 9606
346 5DXB 2 B Estrogen receptor 9606
347 3KMZ 1 A, B Retinoic acid receptor alpha ligand binding domain 9606
348 2B50 1 A, B Peroxisome proliferator activated receptor delta residues 205-476 9606
349 4P6W 1 A Glucocorticoid receptor Ligand binding domain (UNP residues 526-777) 9606
350 4IVY 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
351 3B67 1 A Androgen receptor residues 671-919 9606
352 5XPN 1 A Vitamin D3 receptor UNP residues 116-423 10116
353 3WFF 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
354 2OVH 1 A Progesterone receptor PR LBD 9606
355 4YMQ 1 A Nuclear receptor ROR-gamma Human RORgt ligand binding domain with N-terminal His6-Thrombin tag and a C-terminal linked SRC2 peptide via a GGG linker UNP residues 260-507 9606
356 3WT6 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
357 3OMQ 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
358 5DY8 1 A, B Estrogen receptor ligand-binding domain 9606
359 4N8R 1 A, B, C, D Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
360 3W0G 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 121-164, 212-420 10116
361 4ZI1 1 A Estrogen receptor beta LIGAND BINDING DOMAIN, UNP residues 262-509 9606
362 3IPQ 1 A Oxysterols receptor LXR-alpha Ligand binding domain: UNP residues 182-447 9606
363 3PCU 1 A Retinoic acid receptor RXR-alpha UNP residues 229-458 9606
364 5XPL 1 A Vitamin D3 receptor UNP residues 116-423 10116
365 2AA2 1 A Mineralocorticoid receptor 9606
366 4F9M 1 A Peroxisome proliferator-activated receptor gamma Ligand binding domain, UNP residues 234-505 9606
367 3KPZ 1 A Vitamin D3 receptor Ligand binding domain, residues 118-427 9606
368 4OH5 1 A Androgen receptor ligand binding domain 9606
369 2OUZ 1 A Estrogen receptor Ligand Binding Domain, residues 306-551 9606
370 4IVW 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
371 4MG6 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
372 3ERT 1 A PROTEIN (ESTROGEN RECEPTOR ALPHA) LIGAND-BINDING DOMAIN 9606
373 1S19 1 A Vitamin D3 receptor VDR ligand binding domain 9606
374 3ERD 1 A, B ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN 9606
375 3UUA 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
376 3UUA 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
377 5DRJ 1 A, B Estrogen receptor 9606
378 5DWJ 1 A, B Estrogen receptor ligand-binding domain 9606
379 5E0X 1 A, B Estrogen receptor ligand-binding domain 9606
380 2AYR 1 A Estrogen receptor ligand binding domain, residues 304-551 9606
381 4A4W 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
382 2JF9 1 A, B, C ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 304-533 9606
383 5KCU 1 A, B Estrogen receptor ligand-binding domain 9606
384 5Q15 1 A, C Bile acid receptor 9606
385 5UGM 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
386 2ZFX 1 A Vitamin D3 receptor ligand binding domain 10116
387 5CJ6 1 A Androgen receptor Ligand Binding Domain (UNP residues 641-919) 9606
388 4A2J 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 514-769 9606
389 3CTB 1 A, B Pregnane X receptor, Linker, Steroid receptor coactivator 1 PXR, residues 130-434, linker, SRC-1, residues 678-700 9606 2.3.1.48 | Details
390 2YFE 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
391 3FUG 1 A Retinoic acid receptor RXR-alpha LIGAND BINDING DOMAIN (RESIDUES 223-462) 9606
392 3W5Q 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
393 3B68 1 A Androgen receptor RESIDUES 671-919 9606
394 5TNB 1 A, B, C, D Estrogen receptor ligand-binding domain 9606
395 5Q1A 1 A, C Bile acid receptor 9606
396 5Q1G 1 A Bile acid receptor 9606
397 2YJD 1 A, B ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 261-500 9606
398 3FEJ 1 A Peroxisome proliferator-activated receptor gamma PPAR gamma ligand binding domain 9606
399 2IHQ 1 A Androgen receptor LIGAND-BINDING DOMAIN 10116
400 2HFP 1 A Peroxisome proliferator-activated receptor gamma Ligand Binding Domain (residues 234-505) 9606
401 2A3I 1 A Mineralocorticoid receptor Mineralocoricoid receptor 9606
402 5TLP 1 A, B Estrogen receptor ligand-binding domain 9606
403 5X8U 1 A Uncharacterized protein UNP residues 248-505 61853
404 5KCF 1 A, B Estrogen receptor ligand-binding domain 9606
405 5T1Z 1 A, B Estrogen receptor 9606
406 5DL4 1 A, B Estrogen receptor ligand-binding domain 9606
407 3Q95 1 A Estrogen receptor Ligand Binding Domain residues 298-554 9606
408 3Q95 2 B Estrogen receptor LXXLL motif 2 residues 686-698 9606
409 5Q19 1 A, C Bile acid receptor 9606
410 5DZH 1 A, B Estrogen receptor ligand-binding domain 9606
411 2Q5S 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
412 4MG5 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
413 4A4V 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
414 3W5P 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
415 4NIE 1 A, B Nuclear receptor ROR-gamma ligand binding domain, UNP residues 263-509 9606
416 2R6W 1 A, B Estrogen receptor ligand binding domain, UNP residues 304-551 9606
417 2ZAS 1 A Estrogen-related receptor gamma ligand binding domain, UNP residues 222-459 9606
418 2R6Y 1 A, B Estrogen receptor ligand binding domain, UNP RESIDUES 304-551 9606
419 3VT8 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
420 4IV2 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
421 3K6P 1 A Steroid hormone receptor ERR1 ligand binding domain 9606
422 4PP5 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
423 2ZLA 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
424 5OW7 1 A Vitamin D3 receptor A 7955
425 3OMP 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
426 3V3E 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
427 4REF 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
428 3VJS 1 A Vitamin D3 receptor ligand-binding domain, UNP residues 116-423 10116
429 5NFP 1 A Glucocorticoid receptor 9606
430 4PP6 1 A, B Estrogen receptor ligand-binding domain (UNP residues 305-548) 9606
431 5XMX 1 A, B Peroxisome proliferator-activated receptor delta UNP residues 171-441 9606
432 4J24 1 A, B, C, D Estrogen receptor beta Ligand Binding Domain, UNP residue 261-500' 9606
433 2J7X 1 A ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 255-509 10116
434 3OAP 1 A Retinoic acid receptor RXR-alpha hRXRalpha-LBD, UNP residues 228-458 9606
435 3AFR 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
436 2QR9 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
437 1T74 1 A Androgen receptor ligand binding domain 9598
438 1NRL 1 A, B Orphan nuclear receptor PXR Ligand Binding Domain 9606
439 5TN6 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
440 2ZNN 1 A Peroxisome proliferator-activated receptor alpha Ligand binding domain 9606
441 3FC6 1 A, C Retinoic acid receptor RXR-alpha 9606
442 3FC6 2 B, D Nr1h3 protein 10090
443 1T63 1 A Androgen receptor AR ligand binding domain 9606
444 2PIV 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
445 5V39 1 A Vitamin D3 receptor 9606
446 5TMT 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
447 4MG7 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
448 4MG7 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
449 4POJ 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
450 1Y9R 1 A, B Mineralocorticoid receptor LIGAND-BINDING DOMAIN 9606
451 4OK1 1 A Androgen receptor ligand binding doamin 9606
452 3VHU 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
453 5APJ 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
454 5DUE 1 A, B Estrogen receptor ligand-binding domain 9606
455 4IW8 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
456 4MGC 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
457 3VSO 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
458 3L1B 1 A Farnesoid X receptor Ligand-binding domain, residues 248-476 9606
459 5KRO 1 A, B Estrogen receptor ligand-binding domain 9606
460 5APK 1 A, B NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
461 5TLX 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
462 5NI8 1 A Nuclear receptor ROR-gamma 9606
463 3VRU 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
464 2GTK 1 A Peroxisome proliferator-activated receptor gamma 9606
465 3KMG 1 A, D Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
466 4OKX 1 A Androgen receptor ligand binding doamin 9606
467 3B0Q 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 231-504 9606
468 3HQ5 1 A, B Progesterone receptor residues 678-933 9606
469 5X8S 1 A, B Uncharacterized protein UNP residues 248-505 61853
470 1YIN 1 A Estrogen receptor LIGAND BINDING DOMAIN, residues 307-554 9606
471 2LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD (LIGAND-BINDING DOMAIN), RESIDUES 178 - 423 9606
472 2ZVT 1 A, B Peroxisome proliferator-activated receptor gamma Ligand-binding domain 9606
473 2ZLC 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
474 1X7R 1 A Estrogen receptor 1 (alpha) 9606
475 1XQC 1 A, B, C, D Estrogen receptor ligand binding domain 9606
476 5Q11 1 A Bile acid receptor 9606
477 5TLY 1 A, B Estrogen receptor ligand-binding domain, UNP RESIDUES 125-381 9606
478 4WPF 1 A, D Nuclear receptor ROR-gamma UNP residues 262-509 9606
479 2FAI 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
480 5HZC 1 A, B Peroxisome proliferator-activated receptor gamma 9606
481 5G5W 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, UNP RESIDUES 500-777 9606
482 5Q0T 1 A Bile acid receptor 9606
483 3SP6 1 A Peroxisome proliferator-activated receptor alpha 9606
484 4N5G 1 A, B, C, D Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
485 4OFU 1 A Androgen receptor ligand binding domain 9606
486 5Q1H 1 A, C, E, G Bile acid receptor 9606
487 3F7D 1 A nuclear receptor SF-1 UNP residues 219-462 10090
488 5G45 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
489 5KRM 1 A, B Estrogen receptor ligand-binding domain 9606
490 3NOA 1 A, B Peroxisome proliferator-activated receptor gamma lignad binding domain 9606
491 5LSG 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 223-505 9606
492 4WHG 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
493 2QGT 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
494 5EC9 1 A Retinoic acid receptor RXR-alpha 9606
495 5TMO 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
496 6C42 1 A, B Estrogen receptor 9606
497 3V9Y 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
498 3VJT 1 A Vitamin D3 receptor ligand-binding domain, UNP residues 116-423 10116
499 4EM9 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, UNP RESIDUES 235-505 9606
500 4QM0 1 A, C Nuclear receptor ROR-gamma unp residues 262-507 9606
501 1YYE 1 A, B Estrogen receptor beta Ligand Binding Domain 9606
502 5Q0Y 1 A, C Bile acid receptor 9606
503 2Q59 1 A Peroxisome Proliferator-Activated Receptor gamma CYS A 285 IS 2-HYDROXYETHYLATED Ligand binding domain 9606
504 2Q59 2 B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
505 5DKG 1 A, B Estrogen receptor ligand-binding domain 9606
506 1G5Y 1 A, B, C, D RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN (RESIDUES 225 - 462) 9606
507 2HWQ 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
508 5DI7 1 A, B Estrogen receptor ligand-binding domain 9606
509 1T76 1 A Androgen receptor ligand binding domain 9598
510 4X1G 1 A Nuclear receptor subfamily 1 group I member 2 UNP residues 130-434 9606
511 5Q0M 1 A Bile acid receptor 9606
512 5U3U 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
513 2ZXN 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-423 10116
514 3ADX 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
515 5DX3 1 A Estrogen receptor 9606
516 5DX3 2 B Estrogen receptor 9606
517 3OLS 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
518 2NV7 1 A, B Estrogen receptor beta 9606
519 2Q61 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
520 6EL7 1 A Glucocorticoid receptor Expression and crystallisation mutants: N517D, V571M, F602S, C638D, E684A, W712S 9606
521 3TY0 1 A, B Peroxisome proliferator-activated receptor gamma 9606
522 5UFR 1 A, B Nuclear receptor ROR-gamma UNP residues 265-507 9606
523 3T03 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
524 5GTO 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 1-283 9606
525 5Q10 1 A Bile acid receptor 9606
526 5DZ1 1 A, B Estrogen receptor ligand-binding domain 9606
527 5Q0X 1 A Bile acid receptor 9606
528 4OEA 1 A Androgen receptor ligand binding domain 9606
529 5U44 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
530 5DXK 1 A, B Estrogen receptor ligand-binding domain 9606
531 1XAP 1 A Retinoic acid receptor beta ligand binding domain 9606
532 5TML 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
533 4PP3 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
534 5GID 1 A Vitamin D3 receptor UNP RESIDUES 124-164,UNP RESIDUES 212-419 10116
535 5TLF 1 A, B Estrogen receptor ligand-binding domain 9606
536 3K22 1 A, B Glucocorticoid receptor 9606
537 2AWH 1 A, B Peroxisome proliferator activated receptor delta residues 210-477 9606
538 3D24 1 A, C Steroid hormone receptor ERR1 Ligand binding domain: Residues 278-519 9606
539 5JJM 1 A, C, D Androgen receptor 9606
540 5JJM 3 B Androgen receptor 9606
541 2VSR 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 9-(S)-HODE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
542 4XUH 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 232-505 9606
543 4R06 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 233-505 9606
544 6EL9 1 A Glucocorticoid receptor Expression and crystallisation mutants: N517D, V571M, F602S, C638D, E684A, W712S 9606
545 3GWS 1 X Thyroid hormone receptor beta Ligand Binding Domain (UNP residues 202 to 460) 9606
546 5DRM 1 A, B Estrogen receptor 9606
547 5X8Q 1 A, C, E, G Nuclear receptor ROR-gamma UNP residues 261-518 9606
548 5E15 1 A, B Estrogen receptor ligand-binding domain 9606
549 2P7G 1 A Estrogen-related receptor gamma 9606
550 1UPV 1 A OXYSTEROLS RECEPTOR LXR-BETA LIGAND BINDING DOMAIN, RESIDUES 209-461 9606
551 5DZ3 1 A, B Estrogen receptor ligand-binding domain 9606
552 2F4B 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
553 4R6S 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 231-505 9606
554 3UUC 1 A, B, C, D Estrogen receptor Ligand binding domain (residues 302-552) 9606
555 5TMZ 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
556 4K4J 1 A Retinoic acid receptor RXR-alpha ligand binding domain, UNP residues 228-458 9606
557 1PQ9 1 A, B, C, D Oxysterols receptor LXR-beta Ligand binding domain, residues 213-461 9606
558 5TM3 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
559 3FS1 1 A Hepatocyte nuclear factor 4-alpha HNF4a Ligand Binding Domain 9606
560 3WMH 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain, UNP residues 223-504 9606
561 5DXP 1 A, B Estrogen receptor ligand-binding domain 9606
562 1N46 1 A, B Thyroid hormone receptor Beta-1 9606
563 2B23 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
564 1N4H 1 A Nuclear Receptor ROR-beta Ligand-Binding Domain 10116
565 3OMM 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
566 4RAK 1 A, B Oxysterols receptor LXR-beta UNP residues 213-460 9606
567 3AUR 1 A Vitamin D3 receptor ligand binding domain 9606
568 3ET2 1 A, B Peroxisome proliferator-activated receptor delta LIGAND BINDING DOMAIN 9606
569 5DIG 1 A, B Estrogen receptor ligand-binding domain 9606
570 5DID 1 A, B Estrogen receptor 9606
571 5OWD 1 A Vitamin D3 receptor A 7955
572 1I37 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN 10116
573 1ZDT 1 A, B Steroidogenic factor 1 9606
574 4IWC 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
575 5U3X 1 A, B Peroxisome proliferator-activated receptor delta UNP RESIDUES 131-402 9606
576 4KZJ 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
577 1S0X 1 A Nuclear receptor ROR-alpha ligand binding domain 9606
578 1ZKY 1 A, B Estrogen receptor Ligand Binding Domain 9606
579 5DYB 1 A, B Estrogen receptor ligand-binding domain 9606
580 2P1V 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
581 5DLR 1 A, B Estrogen receptor ligand-binding domain 9606
582 5Q17 1 A Bile acid receptor 9606
583 2PIR 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
584 3B0R 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 231-504 9606
585 5XPM 1 A Vitamin D3 receptor UNP residues 116-423 10116
586 5TM5 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
587 3E7C 1 A, B Glucocorticoid receptor UNP RESIDUES 521-777 9606
588 5UFS 1 A, B Ancestral Glucocorticoid Receptor2 Ligand Binding Domain 32644
589 1T73 1 A Androgen receptor ligand binding domain 9598
590 5TLU 1 A, B Estrogen receptor ligand-binding domain 9606
591 2ZMH 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
592 5VB5 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
593 3VTB 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
594 3HVL 1 A, B Pregnane X receptor, Linker, Steroid receptor coactivator 1 PXR, residues 130-434, linker, SRC-1, residues 678-700 9606 2.3.1.48 | Details
595 2P1U 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
596 4YPQ 1 A Nuclear receptor ROR-gamma UNP residues 265-507 9606
597 1M13 1 A Orphan Nuclear Receptor PXR Includes Ligand Binding Domain (Residues 130-434) 9606
598 3ADW 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
599 2Q70 1 A, B Estrogen receptor ligand-binding domain (Residues 304-551) 9606
600 5DU5 1 A, B Estrogen receptor 9606
601 5TM4 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
602 3G8I 1 A Peroxisome proliferator-activated receptor alpha Ligand bind domain 9606
603 3OKI 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
604 4RE8 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
605 3FXV 1 A NR1H4 protein ligand binding domain, residues 248-475 9606
606 5DUH 1 A, B Estrogen receptor ligand-binding domain 9606
607 5DUG 1 A, B Estrogen receptor ligand-binding domain 9606
608 5DZ0 1 A, B Estrogen receptor ligand-binding domain 9606
609 5TN7 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
610 3VT5 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
611 5NKY 1 A Vitamin D3 receptor A 7955
612 4OFR 1 A Androgen receptor ligand binding domain 9606
613 5E19 1 A, B Estrogen receptor ligand-binding domain 9606
614 3KWY 1 A Retinoic acid receptor RXR-alpha ligand binding domain 9606
615 5C4U 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
616 3UU7 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
617 3UU7 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
618 5DWL 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
619 1PZL 1 A Hepatocyte nuclear factor 4-alpha HNF4A-LDB 9606
620 2PIO 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
621 5LYQ 1 A Retinoic acid receptor RXR-alpha UNP residues 223-462 9606
622 5TM1 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
623 5NFT 1 A Glucocorticoid receptor 9606
624 5TMQ 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
625 2EWP 1 A, B, C, D, E Estrogen-related receptor gamma 9606
626 5TMM 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
627 5TMS 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
628 4Q13 1 A, B Estrogen receptor D538G 9606
629 5TLV 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
630 3LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD, LIGAND-BINDING DOMAIN, RESIDUES 178 - 423 9606
631 3D57 1 A, B Thyroid hormone receptor beta C-terminal domain 9606
632 5DXR 1 A, B Estrogen receptor ligand-binding domain 9606
633 1S9P 1 A, B, C, D Estrogen-related receptor gamma 10090
634 2YHD 1 A ANDROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 671-919 9606
635 5VB7 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
636 5TLG 1 A, B Estrogen receptor ligand-binding domain 9606
637 3PBA 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
638 5TMW 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
639 4R2U 1 A, D Peroxisome proliferator-activated receptor gamma UNP residues 231-505 9606
640 3VJH 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-504 9606
641 5AK2 1 A, B ESTROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 307-554 9606
642 3WTQ 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-423 10116
643 5ZWF 1 A Vitamin D3 receptor 10116
644 4ZNW 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
645 3OMO 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
646 3B0W 1 A, B Nuclear receptor ROR-gamma LIGAND-BINDING DOMAIN, UNP residues 265-507 9606
647 5E14 1 A, B Estrogen receptor ligand-binding domain 9606
648 4LSJ 1 A Glucocorticoid receptor Steroid-binding region, residues 522-777 9606
649 3FUR 1 A Peroxisome proliferator-activated receptor gamma LBD (ligand binding domain), UNP residues 234-505 9606
650 1QKN 1 A ESTROGEN RECEPTOR BETA COMPLEXED WITH THE ANTAGONIST RALOXIFENE LIGAND-BINDING DOMAIN 10116
651 4IU7 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
652 4UDB 1 A MINERALOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 735-984 9606
653 3R5N 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain (UNP residues 232-505) 9606
654 5YP6 1 A Nuclear receptor ROR-gamma 9606
655 3WT7 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
656 2H77 1 A THRA protein 9606
657 5KRI 1 A, B Estrogen receptor ligand-binding domain 9606
658 5TTO 1 A, B Peroxisome proliferator-activated receptor gamma residues 233-505 9606
659 5DIE 1 A, B Estrogen receptor ligand-binding domain 9606
660 5TMR 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
661 5AWJ 1 A Vitamin D3 receptor,Vitamin D3 receptor deletion mutant, residues 165-211 UNP RESIDUES 116-164, 212-423 10116
662 4ZOM 1 A, B, C, D Nuclear receptor ROR-gamma ligand binding domain 9606
663 3OOF 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
664 4IV4 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
665 5TLO 1 A, B Estrogen receptor ligand-binding domain 9606
666 4KZM 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
667 3V3Q 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand-bingding domain, UNP residues 351-598 9606
668 2YLP 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 664-919 9606
669 6FO8 1 1 Vitamin D3 receptor A HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS 7955
670 1FM9 1 A RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN - RESIDUES 225 - 462 9606
671 1FM9 2 D PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN - RESIDUES 206 - 477 9606
672 6F2L 1 A, B Peroxisome proliferator-activated receptor gamma 9606
673 3OSA 1 A, B, C, D Estrogen receptor 9606
674 3SP9 1 A, B Peroxisome proliferator-activated receptor delta ligand binding domain 9606
675 5KRH 1 A, B Estrogen receptor ligand-binding domain 9606
676 5DVC 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
677 5Q16 1 A, C Bile acid receptor 9606
678 5TN9 1 A, B, C, D Estrogen receptor ligand-binding domain 9606
679 5HYR 1 A, B Estrogen receptor UNP Residues 302-559 9606
680 3G9E 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
681 2HC4 1 A Vitamin D receptor Ligand binding domain 7955
682 2AA5 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
683 1S9Q 1 A, B Estrogen-related receptor gamma 10090
684 4L96 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN (UNP RESIDUES 235-505) 9606
685 3X31 1 A Vitamin D3 receptor ligand binding domain (UNP residues 118-164, 216-427) 9606
686 5U2B 1 A, B, C, D, E, F Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
687 5EI1 1 A, B Estrogen receptor ligand-binding domain 9606
688 4YNK 1 A Vitamin D3 receptor,Vitamin D3 receptor UNP residues 116-164,212-423,UNP residues 116-164,212-423 10116
689 5WGQ 1 A, B Estrogen receptor 9606
690 5DK9 1 A, B Estrogen receptor ligand-binding domain 9606
691 1U3R 1 A, B Estrogen receptor beta 9606
692 2PIU 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
693 3L0E 1 A Oxysterols receptor LXR-beta UNP residues 213-461 9606
694 1QKT 1 A ESTRADIOL RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 304-551 9606
695 3OZJ 1 A, C Retinoic acid receptor RXR-alpha ligand-binding domain, UNP residues 225-462 9606
696 5KRL 1 A, B Estrogen receptor ligand-binding domain 9606
697 4QL8 1 A Androgen receptor Androgen receptor ligand binding domain, UNP residues 662-919 9606
698 2AA7 1 A Mineralocorticoid receptor Ligand Binding Domain 9606
699 4K6I 1 A Retinoic acid receptor RXR-alpha ligand binding domain, UNP residues 228-458 9606
700 5DKB 1 A, B Estrogen receptor ligand-binding domain 9606
701 4DMA 1 A, B Estrogen receptor unp residues 303-549 9606
702 2P7A 1 A Estrogen-related receptor gamma 9606
703 5E7V 1 A Vitamin D3 receptor A 7955
704 4J26 1 A, B Estrogen receptor beta Ligand Binding Domain, UNP residues 261-500 9606
705 1X76 1 A, B Estrogen receptor beta 9606
706 1XQ3 1 A androgen receptor inhibited by r1881 ligand binding domain 9606
707 4ZN9 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
708 4XT9 1 A Nuclear receptor ROR-gamma UNP residues 265-507 9606
709 3W5R 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
710 1ZAF 1 A, B Estrogen receptor beta 9606
711 3BC5 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
712 5KRC 1 A, B Estrogen receptor ligand-binding domain 9606
713 2PRG 1 A, B PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LBD (LIGAND BINDING DOMAIN), RESIDUES 207-477 9606
714 6ENQ 1 A, B Peroxisome proliferator-activated receptor gamma 9606
715 2GIU 1 A Estrogen receptor beta LIGAND-BINDING DOMAIN (Residues 260-500) 9606
716 5KR9 1 A, B Estrogen receptor ligand-binding domain 9606
717 3VT9 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
718 3OS9 1 A, B, C, D Estrogen receptor 9606
719 2I4J 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), residues 223-504 9606
720 1NHZ 1 A GLUCOCORTICOID RECEPTOR residue 500-777, hinge and steroid binding domains 9606
721 5DWG 1 A, B Estrogen receptor ligand-binding domain 9606
722 2XYJ 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR DELTA LIGAND BINDING DOMAIN, RESIDUES 165-441 9606
723 2Q5P 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
724 5KRF 1 A, B Estrogen receptor ligand-binding domain 9606
725 5Q0N 1 A, C Bile acid receptor 9606
726 4M8H 1 A Retinoic acid receptor RXR-alpha HRXRALPHA-LBD, UNP RESIDUES 228-458 9606
727 2REW 1 A Peroxisome proliferator-activated receptor alpha ligand binding domain, residues 196-468 9606
728 3SZ1 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
729 4BCR 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN, RESIDUES 195-468 9606 2.3.1.48 | Details
730 1FM6 1 A, U RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN - RESIDUES 225 -462 9606
731 1FM6 2 D, X PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN - RESIDUES 206 - 477 9606
732 4XUM 1 A, B Peroxisome proliferator-activated receptor gamma 9606
733 5DP0 1 A, B Estrogen receptor 9606
734 5HCV 1 A, B, C Mineralocorticoid receptor ligand-binding domain (UNP residues 732-984) 9606
735 3W5T 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
736 5TM7 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
737 4L98 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN (UNP RESIDUES 235-505) 9606
738 4QJR 1 A Steroidogenic factor 1 UNP residues 218-461 9606
739 3H0A 1 A Retinoic acid receptor RXR-alpha UNP RESIDUES 228-455 9606
740 3H0A 2 D Peroxisome proliferator-activated receptor gamma UNP RESIDUES 234-505 9606
741 5DTV 1 A, B Estrogen receptor 9606
742 2HVC 1 A Androgen receptor ligind-binding domain(residues 669-918) 9606
743 2J4A 1 A THYROID HORMONE RECEPTOR BETA-1 LIGAND BINDING DOMAIN, RESIDUES 209-461 9606
744 4RME 1 A Retinoic acid receptor RXR-alpha ligand binding domain 228-458 9606
745 3VT6 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
746 1PDU 1 A, B nuclear hormone receptor HR38 N-terminal, ligand binding domain 7227
747 5DXM 1 A, B Estrogen receptor ligand-binding domain 9606
748 5OW9 1 A Vitamin D3 receptor A 7955
749 4JYG 1 A, B Retinoic acid receptor beta Ligand binding domain, UNP residues 176-421 9606
750 1OVL 1 A, D Orphan nuclear receptor NURR1 (MSE 414, 496, 511) 9606
751 1OVL 2 B, C, E, F Orphan nuclear receptor NURR1 (MSE 496, 511) 9606
752 3KYT 1 A Nuclear receptor ROR-gamma lipid binding domain 9606
753 5XPO 1 A Vitamin D3 receptor UNP residues 116-423 10116
754 5TLD 1 A, B Estrogen receptor ligand-binding domain 9606
755 4HLW 1 A Androgen receptor UNP residues 664-919 9606
756 2G5O 1 A, B Estrogen receptor Ligand Binding Domain 9606
757 2ATH 1 A, B Peroxisome proliferator activated receptor gamma ligand binding domain 9606
758 4RUJ 1 A Vitamin D3 receptor A ligand binding domain, UNP residues 156-453 7955
759 5C4S 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
760 2ABI 1 A, B, C Mineralocorticoid receptor LIGAND-BINDING DOMAIN 9606
761 5X8W 1 A Uncharacterized protein UNP residues 248-505 61853
762 3PO9 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
763 4WHF 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
764 5TMV 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
765 5DVS 1 A, B Estrogen receptor ligand-binding domain 9606
766 2Q3Y 1 A Ancestral Corticiod Receptor Ligand Binding Domain 32644
767 4REE 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
768 1I38 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN 10116
769 5TMU 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
770 5Q1B 1 A, C Bile acid receptor 9606
771 3VHW 1 A Vitamin D3 receptor ligand binding domain, residues 118-427 9606
772 3L0J 1 A Nuclear receptor ROR-gamma Retinoic acid-related orphan receptor gamma 9606
773 5C4O 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
774 2PIN 1 A, B Thyroid hormone receptor beta-1 Ligand-binding domain (residues 209-461) 9606
775 5G3J 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 500-777 9606
776 5DXQ 1 A, B Estrogen receptor ligand-binding domain 9606
777 4POH 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
778 4K7A 1 A Androgen receptor ligand binding domain, UNP residues 670-918 9606
779 5DWI 1 A, B Estrogen receptor ligand-binding domain 9606
780 1I7G 1 A PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN 9606
781 5TLL 1 A, B Estrogen receptor ligand-binding domain 9606
782 4CI4 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN, RESDIUES 195-468 9606 2.3.1.48 | Details
783 4ZNU 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
784 4LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD, LIGAND-BINDING DOMAIN, RESIDUES 178 - 423 9606
785 4XHD 1 A Nuclear receptor subfamily 1 group I member 2 9606
786 4YT1 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 223-504 9606
787 3ADV 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
788 3ADS 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
789 1FBY 1 A, B RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN 9606
790 3PEQ 1 A, B Peroxisome proliferator-activated receptor delta unp residues 171-441 9606
791 1X78 1 A, B Estrogen receptor beta 9606
792 1X7B 1 A, B Estrogen receptor beta 9606
793 5NTI 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
794 2VV1 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 4-HDHA LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
795 2VV1 2 B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 4-HDHA LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
796 4CSJ 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 500-777 9606
797 1HJ1 1 A OESTROGEN RECEPTOR BETA COMPLEXED WITH THE FULL ANTAGONIST ICI164,384 LIGAND-BINDING DOMAIN 10116
798 2NPA 1 A, C Peroxisome proliferator-activated receptor alpha ligand binding domain 9606
799 4XLD 1 A Peroxisome proliferator-activated receptor gamma UNP residues 203-477 9606
800 3HOD 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), UNP residues 223-504 9606
801 4FHH 1 A Vitamin D3 receptor A UNP RESIDUES 156-453 7955
802 5LWP 1 A Nuclear receptor ROR-gamma 9606
803 3ET0 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
804 5Q1F 1 A, C Bile acid receptor 9606
805 2PJL 1 A, B Steroid hormone receptor ERR1 ligand binding domain 9606
806 6BN6 1 A, B Nuclear receptor ROR-gamma Ligand-binding domain 9606
807 5GTP 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
808 5A86 1 A, B NUCLEAR RECEPTOR SUBFAMILY 1 GROUP I MEMBER 2 9606
809 2P4Y 1 A, B Peroxisome proliferator-activated receptor gamma Ligand-binding Domain (LBD), Residues 231-505 9606
810 4OJ4 1 A Peroxisome proliferator-activated receptor gamma Ligand binding domain (UNP residues 232-505) 9606
811 5KRK 1 A, B Estrogen receptor ligand-binding domain 9606
812 2YLQ 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 664-919 9606
813 5F9B 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 195-477 9606
814 5IXK 1 A, B Nuclear receptor ROR-gamma Ligand Binding Domain UNP Residue 268-487 9606
815 3D90 1 A, B Progesterone receptor Ligand-binding domain, UNP residues 676-933 9606
816 4OKT 1 A Androgen receptor ligand binding doamin 9606
817 4EMA 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, UNP RESIDUES 235-505 9606
818 4DM8 1 A, B Retinoic acid receptor beta unp residues 176-421 9606
819 5ZWI 1 A Vitamin D3 receptor 10116
820 6FOD 1 A Vitamin D3 receptor A 7955
821 5KRA 1 A, B, E, F Estrogen receptor ligand-binding domain 9606
822 5NI5 1 A Nuclear receptor ROR-gamma The protein construct include a N-terminal HN-tag and a C-terminal SRC2-2 peptide 9606
823 4N1Y 1 A, B, C, D Estrogen receptor unp residues 245-481 29159
824 3DT3 1 A, B Estrogen receptor ligand binding domain 9606
825 5GIE 1 A, D Vitamin D3 receptor UNP RESIDUES 117-164,UNP RESIDUES 212-419 10116
826 2Q8S 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain (residue 235-505) 9606
827 1XZX 1 X Thyroid hormone receptor beta-1 ligand binding domain (residues 202-461) 9606
828 1PK5 1 A, B Orphan nuclear receptor NR5A2 LRH-1 LBD 10090
829 2POB 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
830 1PRG 1 A, B PROTEIN (PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA) LBD (LIGAND BINDING DOMAIN), RESIDUES 207-476 9606
831 5T92 1 A, B Estrogen receptor residues 301-553 9606
832 4M8E 1 A Retinoic acid receptor RXR-alpha HRXRALPHA-LBD, UNP RESIDUES 228-458 9606
833 3HZF 1 A Thyroid hormone receptor, alpha isoform 1 variant residues 135-397 9606
834 3CS8 1 A Peroxisome proliferator-activated receptor gamma LBD domain (UNP residues 234-504) 9606
835 6FGQ 1 A, B Nuclear receptor ROR-gamma 9606
836 3AN3 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
837 1PQ6 1 A, B, C, D Oxysterols receptor LXR-beta Ligand binding domain, residues 213-461 9606
838 4ZJW 1 A, B Nuclear receptor ROR-gamma ligand binding domain (UNP Residues 265-487) 9606
839 3P89 1 A Farnesoid X receptor unp residues 244-472 9606
840 1T5Z 1 A Androgen receptor AR Ligand Binding Domain 669-918 9606
841 2PIQ 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
842 1E3G 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN RESIDUES 447-709 9606
843 4KZI 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
844 2I4Z 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), residues 223-504 9606
845 3VN2 1 A Peroxisome proliferator-activated receptor gamma Ligand biding domain, UNP residues 225-505 9606
846 3OOK 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
847 4RFW 1 A Retinoic acid receptor RXR-alpha ligand binding domain residues 228-458 9606
848 5EJV 1 A, B Nuclear receptor ROR-gamma Ligand Binding Domain (UNP residues 259-518) 9606
849 1XNN 1 A Androgen receptor LIGAND-BINDING DOMAIN 10116
850 4HEE 1 X Peroxisome proliferator-activated receptor gamma peroxisome proliferator-activated receptor-gamma (UNP Residues 235-505) 9606
851 5Q0Z 1 A, C Bile acid receptor 9606
852 3X1H 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 232-505 9606
853 5GIC 1 A Vitamin D3 receptor UNP RESIDUES 124-164,UNP RESIDUES 212-420 10116
854 5WQX 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 232-505 9606
855 5Q1C 1 A, C Bile acid receptor 9606
856 3O1D 1 A Vitamin D3 receptor A Ligand Binding Domain (UNP Residues 156-453) 7955
857 2Q6S 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
858 1XVP 1 A, C Retinoic acid receptor RXR-alpha LBD domain 9606
859 1XVP 2 B, D Orphan nuclear receptor NR1I3 LBD domain 9606
860 3ZQT 1 A ANDROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 664-919 562
861 1XIU 1 A, B RXR-like protein Ligand-binding domain (LBD) 6526
862 4OAR 1 A Progesterone receptor Steroid-binding Region 9606
863 2JJ3 1 A, B ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 256-505 9606
864 1UOM 1 A ESTROGEN RECEPTOR NVP-ADD562 L SOLVENT S LIGAND BINDING DOMAIN, RESIDUES 301 - 553 9606
865 2ZMJ 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
866 5NTQ 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
867 2I4P 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD) 9606
868 3AN4 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
869 4FHI 1 A Vitamin Nuclear Receptor 7955
870 6FO7 1 A Vitamin D3 receptor A 7955
871 5MKJ 1 A Retinoic acid receptor RXR-alpha 9606
872 1GWQ 1 A, B OESTROGEN RECEPTOR LIGAND-BINDING DOMAIN (DOMAIN E - RESIDUES 260-500) IN COMPLEX WITH THE AGONIST RALOXIFENE CORE LIGAND-BINDING DOMAIN, RESIDUES 301-548 9606
873 5Q0S 1 A, C Bile acid receptor 9606
874 3ET1 1 A, B Peroxisome proliferator-activated receptor alpha LIGAND BINDING DOMAIN 9606
875 2IOK 1 A, B Estrogen receptor Steroid-binding region, residues 306-554 9606
876 3FAL 1 A, C Retinoic acid receptor RXR-alpha residues 225-462 9606
877 3FAL 2 B, D Oxysterols receptor LXR-alpha residues 200-445 10090
878 4OIL 1 A Androgen receptor ligand binding doamin 9606
879 5U5L 1 A, B Peroxisome proliferator-activated receptor gamma residues 233-505 9606
880 3GN8 1 A, B Glucocorticoid receptor 2 9606
881 3GBK 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domian, UNP residues 235-505 9606
882 3QT0 1 A Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
883 5NMB 1 A2 Vitamin D3 receptor A UNP residues 156-453 7955
884 2YAT 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 301-551 9606
885 4OC7 1 A Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
886 5TM9 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
887 3JZC 1 A Thyroid hormone receptor beta UNP residues 202-461, Ligand Binding Domain 9606
888 2VV4 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 6-OXOOTE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
889 2VV4 2 B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 6-OXOOTE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
890 5TM6 1 A, B Estrogen receptor ligand-binding domain 9606
891 2GP7 1 A, B, C, D Estrogen-related receptor gamma Residues 229-458 9606
892 4ITE 1 A Vitamin D3 receptor ligand binding domain, residues 118-427 9606
893 5LGA 1 A Vitamin D3 receptor A 7955
894 5AYG 1 A, B Nuclear receptor ROR-gamma UNP residues 261-518 9606
895 1X7J 1 A, B Estrogen receptor beta 9606
896 1NQ0 1 A Thyroid hormone receptor beta-1 LIGAND BINDING DOMAIN 9606
897 2JFA 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 304-533 9606
898 2JFA 2 B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 304-533 9606
899 3FEI 1 A Peroxisome proliferator-activated receptor alpha PPARalpha ligand binding domain 9606
900 5DMF 1 A, B Estrogen receptor ligand-binding domain 9606
901 1DKF 1 A PROTEIN (RETINOID X RECEPTOR-ALPHA) LIGAND-BINDING DOMAIN 10090
902 1DKF 2 B PROTEIN (RETINOIC ACID RECEPTOR-ALPHA) LIGAND-BINDING DOMAIN 9606
903 3VRW 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
904 5VO4 1 A Androgen receptor UNP residues 671-920 9606
905 3OSW 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
906 2G0H 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain(residues 207-477) 9606
907 1K74 1 A Retinoic acid receptor RXR-alpha ligand binding domain - residues 225 - 462