Sequence Similarity Clusters for the Entities in PDB 1I8K

Entity #1 | Chains: A
EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV LIGHT CHAIN protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 37870
95 % 1 2 32239 Flexibility: Low
Max RMSD: 0.8, Avg RMSD: 0.8
PDBFlex
90 % 1 2 30854
70 % 1 2 27588
50 % 46 347 17
40 % 52 391 27
30 % 744 7755 1
Entity #2 | Chains: B
EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 2 34362
95 % 1 2 30294 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.3
PDBFlex
90 % 1 2 29052
70 % 94 450 8
50 % 116 676 6
40 % 616 6248 1
30 % 745 7755 1
Entity #3 | Chains: C
EPIDERMAL GROWTH FACTOR RECEPTOR, EGFRVIII PEPTIDE ANTIGEN protein, length: 12 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6CNW 1 A humanized antibody SD84h 37965
2 5IVN 1 A BC2-nanobody 30538
3 5E7B 1 A nanobody nano-L06 9838
4 2P45 2 B ANTIBODY CAB-RN05 9838
5 2X1Q 1 A, B GELSOLIN NANOBODY 9844
6 5U64 1 B VHH-28 9838
7 6APO 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
8 2X1P 1 A, B, C, D GELSOLIN NANOBODY 9844
9 4B41 1 A, B ANTIBODY G7 9844
10 5IMM 1 B Nanobody 9835
11 4QYO 1 A Fv fragment(mAb6D8) heavy chain 10090
12 5NLU 1 A single domain llama antibody Nb36 9844
13 1MQK 2 H antibody 7E2 FV fragment, heavy chain 10090
14 5IMK 1 B Nanobody 9835
15 6CWK 1 A Anti-Ricin antibody 30538
16 3TPK 1 A Immunoglobulin heavy chain antibody variable domain KW1 9835
17 4B50 1 A 2H10 LLAMA VHH 9844
18 6DBA 1 A, B nanobody VHH R303 9838
19 2XT1 2 B CAMELID VHH 9 30538
20 4QY8 1 A Fv fragment(mAb6D8) heavy chain 10090
21 5VLV 1 A Single Domain Camelid Nanobody VHH T9 9844
22 5J1S 3 C VHH domain BS-2 30538
23 2P49 2 B ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
24 5J1T 3 C VHH domain BS-2 30538
25 5M13 2 B synthetic Nanobody L2_C06 (a-MBP#2) 32630
26 2X1O 1 A, B GELSOLIN NANOBODY 9844
27 4QGY 1 A, B nanobody n25, VH domain 9844
28 5C2B 1 H scFv 3B4 heavy chain 9606
29 5VNV 1 A Nb.b201 32630
30 5DXW 1 A PD-L1 nanobody 10090
31 4N9O 2 B Nanobody Nb484 Nb484 9844
32 4M3K 2 B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
33 1OAQ 1 H HEAVY CHAIN FV, RESIDUES 1-121 10090
34 1T2J 1 A M12-Variable Heavy domain 9606
35 1DLF 2 H ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) FV FRAGMENT (VH AND VL DOMAINS) 10090
36 6DBF 2 B InlB specific VHH R303 9838
37 6DBG 2 C, D VHH R303 9838
38 2XA3 1 A LLAMA HEAVY CHAIN ANTIBODY D7 VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
39 5VM6 1 A single domain camelid nanobody VHH T10 9844
40 1RJC 1 A camelid heavy chain antibody VHH DOMAIN, VARIABLE DOMAIN 9838
41 4KML 2 B Nanobody 9844
42 4Z9K 2 B VHH2(F5) antibody 30538
43 1J05 2 B, H anti-CEA mAb T84.66, heavy chain Fv fragment 10090
44 5LMW 1 A Nanobody 9844
45 5NM0 1 A, B, C, D Nb36 9844
46 6H6Y 2 E, F, G, H Nanobody (VHH) Nano-7 30538
47 4QXT 1 A Fv fragment(mAb6D8) heavy chain 10090
48 4WEM 2 B Anti-F4+ETEC bacteria VHH variable region 9844
49 4PPT 1 A Engineered single domain VHH antibody 9844
50 3R0M 1 A, B Llama VHH A12 9844
51 3ZKQ 2 D XA4813 9844
52 4I13 2 B Protein ca1697 (nanobody) 9844
53 5C2U 1 B Nanobody Nanobody 9838
54 1XFP 1 A heavy chain antibody VHH domain 9838
55 4POY 1 A VHH-metal 9844
56 1A2Y 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
57 5M2W 1 A, B Llama nanobody nb8 against TssK from T6SS 9844
58 5NLW 1 A nanobody Nb36 9844
59 2DLF 2 H PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) FV FRAGMENT (VH DOMAIN) SYNONYM: ANTI-DANSYL FV FRAGMENT 10090
60 1ZVH 2 A Immunoglobulin heavy chain antibody variable domain D2-L24 9838
61 2X6M 1 A HEAVY CHAIN VARIABLE DOMAIN FROM DROMEDARY ENGINEERED FROM IMMUNISED DROMEDARY 9838
62 3G9A 2 B Minimizer 9838
63 2P43 2 B ANTIBODY CAB-RN05 9838
64 4KRN 1 A Nanobody/VHH domain EgA1 9844
65 4GFT 2 B Nanobody 9844
66 4TVS 2 a, b VHH Domain BS-1 30538
67 4W6Y 2 B Nanobody NbFedF9 9844
68 6EZW 1 B VHH antibody BCD090-M2 9844
69 1UAC 2 H Ig VH,anti-lysozyme 10090
70 4HEM 2 E, F, G Anti-baseplate TP901-1 Llama vHH 02 9844
71 4R3S 1 A FV FRAGMENT(MAB6D8) HEAVY CHAIN 10090
72 5M14 2 C, D synthetic Nanobody L2_G11 (a-MBP#2) 32630
73 1YC7 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33 9838
74 5O02 2 C Nanobody (VHH) Nano-4 30538
75 1KXQ 2 E, F, G, H antibody VHH fragment CABAMD9 9838
76 4X7F 2 C, D Nano-25 Nanobody 30538
77 4UT7 1 H BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11 SCFV HEAVY CHAIN DOMAIN, RESIDUES 1-130 9606
78 4LGR 2 B Camelid nanobody (VHH3) 30538
79 5J57 2 B VHH single chain antibody V5E1 30538
80 6BA5 2 B, D, F, H Variable domain Heavy chain, antibody R11 9606
81 1MFA 2 H IGG1-LAMBDA SE155-4 FAB (HEAVY CHAIN) 10090
82 5OMM 2 C Nanobody (VHH) Nano-14 30538
83 5E03 1 A mouse CTLA-4 nanobody 10090
84 5LZ0 1 A, B PorM nanobody 9844
85 1KXV 2 C, D CAMELID VHH DOMAIN CAB10 9838
86 6DBE 1 A, B nanobody VHH R303 9844
87 2XXC 1 B CAMELID VHH 9 30538
88 3QYC 1 A, B VH domain of IgG molecule 9606
89 5VAK 2 B Nb914 Nanobody 9844
90 2XXM 2 B CAMELID VHH 9 30538
91 3QXT 1 A, B Anti-Methotrexate CDR1-3 Graft VHH 9844
92 6DBD 1 A, B, C, D nanobody VHH R326 9844
93 5JDS 1 B Nanobody 9835
94 4OB5 1 H 4E10 antibody germline precursor 7 heavy chain Fv 9606
95 1ZVY 1 A Immunoglobulin heavy chain antibody variable domain D3-L11 9838
96 1U0Q 1 A, B immunoglobulin heavy chain variable domain 9844
97 5L21 2 B VHH-C2 30538
98 5FWO 1 A NANOBODY 9844
99 5KVE 3 H ZV-48 Antibody scFv Heavy chain 10090
100 1OL0 1 A, B IMMUNOGLOBULIN G VARIABLE HEAVY DOMAIN 9606
101 3B9V 1 A, B, C, D heavy chain variable domain 9606
102 4W2P 1 A, B, C, D Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
103 1VFA 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
104 5N88 1 A, H VH59 antibody 9606
105 2D7T 1 H anti polyhydroxybutyrate antibody Fv, heavy chain residues 1-133 9606
106 2OTU 2 B, D, F, H Fv heavy chain variable domain 10090
107 6APP 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody A 9844
108 2E27 2 H anti-ciguatoxin antibody, heavy chain Fv fragment 10090
109 4POU 2 B VHH Antibody 9844
110 1MVF 1 A, B immunoglobulin heavy chain variable region 9838
111 4JVP 1 A, B Anti-HCV E2 alpaca nanobody D03 30538
112 3QSK 2 B Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant 9838
113 6H70 2 C, D Nanobody (VHH) Nano-62 30538
114 4EJ1 2 C, D Nb113 camelid antibody fragment 9844
115 2P42 2 B, D ANTIBODY CAB-RN05 9838
116 1I8K 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
117 4QLR 1 A, B Llama nanobody n02 VH domain 9844
118 5J56 2 B VHH single chain antibody V1C7 30538
119 4NBX 2 B A20.1 VHH 9844
120 1G7J 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
121 4HEP 2 G vHH17 domain 9844
122 3QXU 1 A, B, C, D Anti-Methotrexate CDR1-3 Graft 9844
123 1VFB 2 B IGG1-KAPPA D1.3 FV (HEAVY CHAIN) 10090
124 5IML 2 B Nanobody 9835
125 3A6C 2 H IG VH, anti-lysozyme 10090
126 2DQD 2 H Ig VH,anti-lysozyme 10090
127 1HCV 1 A IMMUNOGLOBULIN G FROM IMMUNIZED LLAMA HEAVY CHAIN VARIABLE DOMAIN FROM LLAMA 9844
128 1G7I 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
129 3A67 2 H IG VH, anti-lysozyme 10090
130 1RI8 1 A camelid ANTIBODY HEAVY CHAIN VHH domain, VARIABLE DOMAIN 9838
131 1J1X 2 H Ig VH,anti-lysozyme 10090
132 5M2J 2 D Anti-(ED-B) scFV 9606
133 2DQC 2 H Ig VH,anti-lysozyme 10090
134 1J1O 2 H Ig VH,anti-lysozyme 10090
135 1MVU 2 B Ig VDJ-region (HEAVY CHAIN) LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER 10090
136 4M62 2 H, I GEP2 FV heavy chain 9606
137 5IVO 1 A BC2-nanobody 30538
138 1J1P 2 H Ig VH,anti-lysozyme 10090
139 4NBZ 2 B, D A26.8 VHH 9844
140 5AYU 2 H Ig VH,anti-lysozyme 10090
141 3A6B 2 H IG VH, anti-lysozyme 10090
142 2DQJ 2 H Ig VH,anti-lysozyme 10090
143 5F21 2 B nanobody MU375 9844
144 1N4X 2 H, I immunoglobulin heavy chain variable region 10090
145 2P44 2 B ANTIBODY CAB-RN05 9838
146 1KIQ 2 B MONOCLONAL ANTIBODY D1.3 10090
147 5TP3 1 A, B F-VHH-4 9844
148 5E0Q 1 A Anti-Nup98 Nanobody TP377 30538
149 4LHJ 2 B Camelid antibody 30538
150 4BEL 2 D, E XA4813 9844
151 5M7Q 1 A, B Nanobody NbD2 9838
152 5H8D 1 A VHH nanobody 9844
153 3LN9 1 A Immunoglobulin heavy chain antibody variable domain B10 9835
154 5IP4 1 A, B XA4551 NANOBODY AGAINST C-DCX 9844
155 3DUR 2 B, D Ig-like protein 10090
156 2XV6 2 B, D CAMELID VHH 9 30538
157 4QO1 1 A Nb139 Nanobody against the DNA-binding domain of p53 9844
158 5VM0 1 A, B Camelid Nanobody VHH T9 9844
159 4ZG1 1 A, B, C, D, E, F NB17 9844
160 6BAN 2 B, D, F, H Variable domain R11 Heavy chain 9606
161 4I1N 2 B Protein ca1697 (nanobody) 9844
162 3QXW 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
163 6F0D 1 A, B VHH antibody BCD090-M2 9844
164 1FGV 2 H H52 FV (HEAVY CHAIN) 9606
165 4LCI 2 H anti canine CD28 antibody, 1C6, heavy chain 10090
166 4W6X 2 B Nanobody NbFedF7 9844
167 5JA9 2 A, B Nanobody 6 9844
168 1A7N 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
169 1JTP 1 A, B Single-Domain Antibody VH DOMAIN FRAGMENT 9838
170 1OP9 1 A HL6 camel VHH fragment 9838
171 2P4A 2 B, D ANTIBODY CAB-RN05 TRUNCATED AT RESIDUE 121 9838
172 4LRN 1 H GEP 1 heavy chain 9606
173 4S11 1 A GELSOLIN NANOBODY 9844
174 4WEN 2 B Anti-F4+ETEC bacteria VHH variable region 9844
175 2YC1 1 A, D SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN 9606
176 5HGG 2 S, T Camelid Derived Antibody Fragment, Nb4 30538
177 6APQ 1 A Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
178 1SHM 1 A, B, D, E ANTIBODY RIG RIG VHH 9844
179 1G7H 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
180 4Y7M 1 A, B Hi113 protein 9844
181 5JMO 2 C, D camelid VHH fragment 9838
182 1A7O 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
183 1KIR 2 B MONOCLONAL ANTIBODY D1.3 10090
184 4B5E 1 A, B PS2-8 9844
185 2DQE 2 H Ig VH,anti-lysozyme 10090
186 1DVF 2 B FV D1.3 IGG1, KAPPA 10090
187 1DVF 4 D FV E5.2 IGG1, KAPPA 10090
188 1G7M 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
189 4X7C 2 C, D Nano-85 Nanobody VHH 30538
190 1OAU 1 H, I, J, K IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
191 3EBA 1 A CAbHul6 9838
192 3ZHD 1 A, B MG8-4 SCAFFOLD ANTIBODY HUMAN HEAVY CHAIN DOMAIN 9606
193 1A6W 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
194 1A7R 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
195 5VM4 1 A, B, C, D, E, F, G, H, I, J, K, L Single domain camelid nanobody VHH T10 9844
196 1WZ1 2 H Ig heavy chain Fv fragment(residues 1-123) 10090
197 4I0C 2 C, D cAbHuL5 antibody 9838
198 1A7P 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
199 1XIW 4 D, H immunoglobulin heavy chain variable region 10090
200 5NGV 2 H anti-human ActRIIB mAb BYM338 heavy-chain C-terminal His6-tag VH 9606
201 1A7Q 2 H IGG1-KAPPA D1.3 FV (HEAVY CHAIN) FV FRAGMENT 10090
202 5BOP 1 A, C Nanobody 9844
203 4DKA 1 A, B single domain antibody VHH 9844
204 5O05 1 C, D Nanobody (VHH) Nano-42 30538
205 1OHQ 1 A, B IMMUNOGLOBULIN FV FRAGMENT, RESIDUES 1-120 9606
206 1DSF 2 H ANTICANCER ANTIBODY B1 FV 10090
207 3DUU 2 B, D Ig-like protein 10090
208 3K74 2 B Nanobody 9844
209 5M15 2 C, D Synthetic nanobody L2_D09, (a-MBP#3) 32630
210 1KIP 2 B MONOCLONAL ANTIBODY D1.3 10090
211 6A3W 1 A, D, G, J utomilumab VH 9606
212 2EIZ 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
213 1SJV 1 A r9 llama VHH single domain antibody 9844
214 6CK8 1 A, B, C Llama antibody SD38 9844
215 4M3J 1 A, B Camelid heavy-chain antibody variable fragment cAb-H7S 9844
216 5VL2 1 A, B, C, D, E, F, G, H T4 nanobody 9844
217 6GZP 1 A Nanobody 9844
218 2UZI 1 H ANTI-RAS FV HEAVY CHAIN 9606
219 6H6Z 2 C, D Nanobody (VHH) Nano-62 30538
220 1UA6 2 H Ig VH,anti-lysozyme 10090
221 1IC7 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
222 4W68 1 A, B Single domain antibody 9844
223 6FYS 1 A, B, C, D, E, F, G, H Single domain antibody SD83 9844
224 1JTT 1 A Vh Single-Domain Antibody VH domain fragment 9838
225 1CFV 2 H MONOCLONAL ANTIBODY FV4155 FV FRAGMENT 10090
226 3EAK 1 A, B NbBCII10-FGLA 9838
227 1KXT 2 B, D, F IMMUNOGLOBULIN VHH FRAGMENT 9838
228 4ORZ 3 C single domain antibody sdAb19 9844
229 4UU9 1 A, H MEDI7814 VARIABLE DOMAIN HEAVY CHAIN 9606
230 6EY6 2 I, J, K, L, M, N, O, P nb130 9844
231 2VYR 2 E, F, G, H, I, J, K, L HUMAN SINGLE DOMAIN ANTIBODY 9606
232 1G7L 2 B ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3 HEAVY CHAIN 10090
233 1BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
234 5C1M 2 B Nanobody 39 9844
235 5F7K 2 C, D Nanobody Nb-ER19 9844
236 5LMJ 1 A, B, C, D nanobody 9844
237 5E1H 2 B F8(JOB10) VHH antibody 30538
238 1F2X 1 K, L ANTIBODY HEAVY CHAIN 9838
239 4OCM 3 C, F Nb1 9844
240 5HDO 1 A, B, C, D Anti-HCV NS3/4A serine protease immoglobulin heavy chain 9838
241 1A6U 2 H B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
242 4X7E 2 C, D Nano-85 Nanobody 30538
243 5F1O 2 B nanobody MU551 9844
244 1ZV5 2 A immunoglobulin heavy chain antibody variable domain VHH D2-L29 9838
245 5O03 2 C, D Nanobody (VHH) Nano-32 9844
246 2DQI 2 H Ig VH,anti-lysozyme 10090
247 4Y8D 2 C, D nanobody 9844
248 3CX5 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
249 4EIZ 2 C, D Nb113 Camel antibody fragment 9844
250 1I3U 1 A ANTIBODY VHH LAMA DOMAIN 9844
251 1I3V 1 A, B ANTIBODY VHH LAMA DOMAIN 9844
252 4C58 2 B NANOBODY 9844
253 5B8C 2 B, E, H, K Pembrolizumab heavy chain variable region (PemVH) 9606
254 3DV6 2 B Ig-like protein 10090
255 4LAJ 3 H, I, L, M Llama single domain antibody, JM4 9844
256 2EKS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
257 5VXM 2 B Single-domain antibody 20ipaD 30538
258 4XVJ 2 H antibody heavy chain variable domain 9606
259 4IDL 1 A Single Domain Antibody VHH A9 9844
260 1JV5 2 B Ig chain heavy chain precursor V region 9606
261 1FVC 2 B, D IGG1-KAPPA 4D5 FV (HEAVY CHAIN) 9606
262 3K7U 1 A Antibody 9844
263 4Z0X 2 B Antibody HC26AM heavy chain variable domain 9606
264 1IC5 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
265 4NBY 2 B, C A20.1 VHH 9844
266 4X7D 2 C, D Nano-85 Nanobody VHH 9844
267 5VAN 2 B Nb914 Nanobody 9844
268 5F7N 2 C, D Nanobody Nb-ER19 30538
269 5OCL 1 A, C, F, H anti-llama nanobody 30538
270 5OCL 2 B, D, E, G anti-vglut nanobody 9844
271 4LAS 1 H Single heavy chain Variable fragment Heavy chain 10090
272 2A9M 2 H, I fluorescein-scfv heavy chain 9606
273 5E5M 2 B, D, F, H mouse anti CTLA-4 nanobody 10090
274 1SJX 1 A immunoglobulin VH domain 9844
275 3ZKS 2 D XA4813 9844
276 6FYW 3 C Single domain antibody SD83 EVQLVESGGGLVQPGGSLRLSCAATGFTLENKAIGWFRQTPGSEREGVLCISKSGSWTYYTDSMRGRFTISRDNAENTVYLQMDSLKPEDTAVYYCATTTAGGGLCWDGTTFSRLASSWGQGTQVTVSS 9844
277 6H72 2 C, D Nanobody (VHH) Nano-94 30538
278 1A6V 2 H, I, J B1-8 FV (HEAVY CHAIN) FV FRAGMENT 10090
279 5MY6 2 B Nanobody 2Rs15d 9838
280 3DUS 2 B, D Ig-like protein 10090
281 5NH3 2 H, I anti-human ActRIIB mAb BYM338 Fv heavy-chain 9606
282 5M2I 2 G, H, I, J, K, L VHH1 9844
283 5MWN 2 D, E, F llama nanobody raised against TssK, nbK18 9844
284 5MWN 3 N llama nanobody raised against TssK, nbK27 9844
285 3ZHK 1 A, B MG2X1 SCAFFOLD ANTIBODY 9606
286 3K1K 2 C, D Enhancer 9838
287 4U7S 1 A, B sdAb A3 9844
288 4U3X 1 A, C Human VH domain antibody 9606
289 4W81 1 A Single Domain Antibody 9844
290 5GRV 1 L homo-specific diabody heavy chain 9606
291 5JMR 1 A, B camelid VHH fragment 9838
292 4W70 1 A Single Domain Antibody 9844
293 2GSG 2 B, D monoclonal antibody heavy chain variable domain 10090
294 5TBD 1 A, D, E, J Fv fragment (mAb4D1) heavy chain 10090
295 4BFB 2 D, E XA4813 9844
296 5DHV 1 A Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
297 5DHV 3 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
298 43C9 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
299 1NMB 3 H FAB NC10 RESOLUTION OF 2.5 ANGSTROMS 10090
300 5LHR 2 B Camelid-Derived Antibody Fragment Nb22 30538
301 1I8I 2 B EPIDERMAL GROWTH FACTOR RECEPTOR ANTIBODY MR1SCFV HEAVY CHAIN 10090
302 1OAR 1 H, I, J, K IMMUNOGLOBULIN E FV, RESIDUES 1-122 10090
303 4LHQ 2 B, D Camelid nanobody 30538
304 3DV4 2 B Ig-like protein 10090
305 6H71 2 C, D Nanobody (VHH) Nano-94 30538
306 3ZKX 2 B XA4813 9844
307 3ZKX 3 C XA4815 9844
308 5F1K 2 C, D nanobody MU1053 9844
309 3ZLQ 2 C, D XA4813 9844
310 1I3G 2 H ANTIBODY FV FRAGMENT VH DOMAIN 10090
311 1DL7 2 H PROTEIN (ANTIBODY M3C65 (HEAVY CHAIN)) FV (SINGLE CHAIN) 10090
312 4NC0 2 B A26.8 VHH 9844
313 1OCW 1 H IMMUNOGLOBULIN E FV REGION, RESIDUES 1-121 10090
314 1IGM 2 H IGM-KAPPA POT FV (HEAVY CHAIN) 9606
315 5GS1 2 B, N, P, R heavy chain 9606
316 5F7Y 3 C, D Nanobody Nb-ER19 9844
317 2DQG 2 H Ig VH,anti-lysozyme 10090
318 5IMO 1 B Nanobody 9835
319 5U65 1 A, B VHH-5 9838
320 4TYU 1 A, B Single Domain Antibody 9844
321 43CA 2 B, D, F, H PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN)) FV 10090
322 2DQH 2 H Ig VH,anti-lysozyme 10090
323 4AQ1 2 B, D NBKB6 VHH 9844
324 6FV0 2 F nanobody 9844
325 4EIG 2 B CA1698 camel antibody fragment 9844
326 3EHB 3 C FV fragment Chain H 10090
327 6B20 3 E, F Nanobody against G protein beta gamma dimer 9844
328 3HB3 3 C ANTIBODY FV FRAGMENT 10090
329 4FFY 2 H DENV1-E111 single chain variable fragment (heavy chain) 10090
330 2X89 1 A, B, C ANTIBODY 9838
331 5M2M 2 D, E, F, H, J, N Llama nanobody VHH3 9844
332 5O04 2 E, F Nanobody (VHH) Nano-26 30538
333 5O04 3 C, D Nanobody (VHH) Nano-85 30538
334 5LBS 2 H, I BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 ScFv fragment, heavy chain 9606
335 3P9W 2 B, D, F, H human VEGF 9606
336 1AP2 2 B, D MONOCLONAL ANTIBODY C219 LIGHT AND HEAVY CHAINS LINKED WITH A SYNTHETIC (GGGGS)3 LINKER FV 10090
337 5F8R 2 C, D Nanobody Nb-ER19 9844
338 1IC4 2 H IGG1 FAB CHAIN H RESIDUES 1-114 10090
339 4OCL 3 C, F Nb1 9844
340 4RAV 2 A, C single-chain Fv, VH 9606
341 5XJ4 2 H durvalumab-VH 9606
342 5LWY 2 H V REGION HEAVY CHAIN 10090
343 1KB9 10 J HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
344 4X4X 1 A, C Human Variable Heavy Chain of Herceptin 9606
345 4IOS 2 D, E, F, G Llama nanobody 11 9844
346 5LHN 2 B Camelid-Derived Antibody Fragment Nb7 30538
347 2BFV 2 H FV4155 MONOCLONAL ANTIBODY FV FRAGMENT 10090
348 2IBZ 10 X Variable Heavy chain of antibody fragment 10090
349 4C57 2 C, D NANOBODY 9844
350 3ZHL 1 A MG8-14 SCAFFOLD ANTIBODY 9606
351 4OCN 3 C, F Nb1 9844
352 4GRW 3 E, G Nanobody 124C4 9844
353 4GRW 4 F, J Nanobody 37D5 9844
354 4GRW 5 H, I Nanobody 22E11 9844
355 5G5R 2 B NANOBODY NB330 SELECTED FROM LLAMA GLAMA 9844
356 4NC2 2 B B39 VHH 9844
357 2WZP 2 D, E, F, J, K, L CAMELID VHH5 9844
358 5LHQ 2 B Camelid-Derived Antibody Fragment Nb7 30538
359 1WT5 1 A, B ANTI EGFR ANTIBODY FV REGION VH fragment 9606
360 6EY0 2 E, G, H llama nanobody nb01 9844
361 6EY0 3 F llama nanobody nb01 9844
362 1JHL 2 H IGG1-KAPPA D11.15 FV (HEAVY CHAIN) 10090
363 5F9A 2 C Nanobody Nb-ER19 9844
364 4LLV 1 A, C, E, H 4E10 Fv heavy chain 9606
365 4LAR 1 H Single heavy chain variable fragment Heavy Chain 10090
366 5CBA 1 A, C 3b4 heavy chain 9606
367 5VXJ 2 B, D, F, H, J single-domain antibody JMK-E3 30538
368 1A14 2 H NC10 FV (HEAVY CHAIN) VH DOMAIN OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIVE-RESIDUE POLYPEPTIDE LINKER 10090
369 1C08 2 B ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10) VH FRAGMENT 10090
370 2OTW 2 B, D Fv heavy chain variable domain VH 10090
371 3STB 1 A, B single domain antibody VHH 9844
372 2YSS 2 B ANTI-LYSOZYME ANTIBODY FV REGION VH FRAGMENT 9606
373 4W6W 2 B NbFedF6 9844
374 5JA8 2 B, D, F, H Nanobody 2 9844
375 2YBR 1 A, D, G SINGLE CHAIN ANTIBODY FRAGMENT 9004G HEAVY CHAIN, RESIDUES 1-117 9606
376 2BJM 1 H IGE SPE7 HEAVY CHAIN ANTHRONE ATTACHED HEAVY CHAIN, RESIDUES 1-120 10090
377 1P4B 2 H Antibody Variable heavy chain 10090
378 5U4M 2 B V1C7 VHH antibody 30538
379 5O0W 2 E, F, G, H Nb474 30538
380 4Y5V 1 A, D, G diabody 305 VH domain 9606
381 1DQL 2 H IGM MEZ IMMUNOGLOBULIN HEAVY CHAIN VARIABLE DOMAIN FRAGMENT 9606
382 6MTJ 2 D 35O22 scFv heavy chain portion 9606
383 1JTO 1 A, B Vh Single-Domain Antibody VH domain fragment 9838
384 3V0A 3 C Llama antibody F12 9844
385 6FYU 3 C, F, I Single domain antibody SD36 9844
386 5F97 2 E, F, G, H Nanbody Nb-ER19 9844
387 3K80 1 A, B Antibody 9844
388 5VAQ 2 B Nb914 Nanobody 9844
389 1QD0 1 A VHH-R2 ANTI-RR6 ANTIBODY VARIABLE DOMAIN OF A HEAVY CHAIN ANTIBODY 9844
390 5F8Q 2 C, D Nanobody Nb-ER19 9844
391 4U05 1 A, B Single Domain Antibody 9844
392 5F9D 2 C Nanobody Nb-ER19 9844
393 4X4Y 1 A, C Human Variable Heavy Chain of Herceptin 9606
394 4LGP 2 B, D VHH1 camelid nanobody 30538
395 2P48 2 B ANTIBODY CAB-RN05 9838
396 5U4L 2 B V1C7 VHH antibody G29R variant 30538
397 5VXK 1 B single-domain antibody JMK-H2 30538
398 5F7M 2 C, D Nanobody Nb-ER19 9844
399 5NBL 3 E, F nAct-Nanobody N-actin and Arp4 specific nanobody with a C-terminal double Strep-Tag. 30538
400 5DA4 1 A, B, C Nanobody recognizing the membrane protein SLC26Dg 9844
401 5F7W 2 C, D Nanobody Nb-ER19 9844
402 4YQX 1 H, N JES6-1 VH domain 10116
403 1EZV 10 X HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
404 3U6R 1 A, H Antibody 1:7 (Heavy chain) 9606
405 1NMC 2 B, H SINGLE CHAIN ANTIBODY VH AND VL DOMAINS OF ANTI-NEURAMINIDASE ANTIBODY NC10 COVALENTLY JOINED BY A FIFTEEN RESIDUE POLYPEPTIDE LINKER 10090
406 1MEL 1 A, B VH SINGLE-DOMAIN ANTIBODY 9838
407 4NC1 2 C, D A20.1 VHH 9844
408 4NC1 3 E, F A26.8 VHH 9844
409 5M30 2 D, E, F Anti-vesicular stomatitis virus N VHH 30538
410 4WEU 1 D, E Anti-F4+ETEC bacteria VHH variable region 9844
411 2DQF 2 B, E Ig VH,anti-lysozyme 10090
412 5E7F 1 A, B, C nanobody L06 9838
413 2P46 2 B, D ANTIBODY CAB-RN05 9838
414 6MTN 2 D 35O22 scFv heavy chain portion 9606
415 3CXH 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT 10090
416 6MU7 2 D 35O22 scFv heavy chain portion 9606
417 5YOY 3 G, H, I, P, Q, R Golimumab heavy chain variable region 9606
418 5LWF 2 C, D Camelid heavy-chain antibody variable fragment cAb-G10S 9844
419 5LHP 2 B Camelid-Derived Antibody Fragment 30538
420 5USF 2 C, D Immunoglobulin heavy chain variable region 9844
421 1P84 10 J Heavy Chain (Vh) Of Fv-Fragment 10090
422 5SV4 1 A, B Single Domain Antibody A3C8 9844
423 4LGS 2 B Camelid nanobody (VHH4) 30538
424 3QXV 1 A, B, C, D, E Anti-Methotrexate CDR1-4 Graft VHH 9844
425 5Y80 2 B NANOBODY 9844
426 2XTJ 4 D FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05 HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131 9606
427 5CBE 1 A, C E10 heavy chain 9606
428 2P47 2 B ANTIBODY CAB-RN05 9838
429 4KRM 2 B, D, F, H, J, L Nanobody/VHH domain 7D12 9844
430 3WXW 2 H V region heavy chain 10090
431 3K3Q 1 A llama Aa1 VHH domain 9844
432 4P2C 3 G, H, I, J, K Nanobody 1, Anti-F4+ETEC bacteria VHH variable region 9844
433 1AR1 3 C ANTIBODY FV FRAGMENT 10090
434 3EZJ 2 B, D, F, H NANOBODY NBGSPD_7 9844
435 5VNW 2 C, D Nb.b201 32630
436 1BVK 2 B, E HULYS11 FV 9606
437 6FE4 2 F, G, H, I, J Nb113 30538
438 5NML 1 A, B, C, D, E, F, G, H, I, J Nanobody Nb36 Ser85Cys 9844
439 6MU6 2 D 35O22 scFv heavy chain portion 9606
440 2CJU 1 H NQ16-113.8 ANTI-PHOX ANTIBODY 10090
441 6CWG 2 B, D VHH antibody 30538
442 5HVF 2 B VHH-i83 30538
443 1P4I 2 H antibody variable heavy chain 10090
444 4PGJ 1 A, C Human heavy chain domain antibody 9606
445 4KDT 1 A, B Nanobody24 9835
446 6H02 2 B LAMA nanobody NB106 Lama nanobody generated against Human Mediator subunit MED23 9844
447 3CFI 3 C, F, I, L Nanobody NBEPSIJ_11 9844
448 2VH5 1 H ANTI-RAS FV HEAVY CHAIN 9606
449 4S10 1 A, B GELSOLIN NANOBODY GELSOLIN NANOBODY 9844
450 6FYT 3 I Single domain antibody SD38 9844
451 5MJE 2 B Nanobody 8 9844
452 3LH2 2 H, I, J, K Fv 4E10 heavy chain 9606
453 3OGO 2 E, F, G, H GFP-nanobody 9838
454 4C59 2 B NANOBODY 9844
455 5VXL 2 B single-domain antibody JPS-G3 30538
456 1OAZ 2 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
457 6H7N 3 C, D Camelid antibody fragment Nb6B9 9844
458 4DK6 1 A, B single domain antibody VHH 9844
459 5F93 2 C, D, F, H Nanobody Nb-ER19 9844
460 5F7L 2 B, D Nanobody Nb-ER14 9844
461 1OAY 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
462 5HVG 2 B, D VHH-a204 30538
463 4LAQ 1 H Single heavy chain variable fragment Heavy chain 10090
464 3UPC 1 A, B, C, D, E, F, G, H, I, J heavy chain variable domain 9606
465 4W2Q 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody C 9844
466 5HVH 2 B VHH-a204 30538
467 5HVH 3 C VHH-i83 30538
468 4XT1 3 C nanobody 7 30538
469 5LXG 2 H V REGION HEAVY CHAIN 10090
470 5HM1 1 A, B, C lama VHH antibody 2E7 9844
471 5NBM 3 E, F nAct-Nanobody N-actin and Arp4 binding nanobody with a C-terminal double Strep-Tag. 30538
472 5FUC 3 E, V VHH6 9838
473 4RZC 1 A, C, E, H Fv M6P-1 light chain 9986
474 3H3P 1 H, I Fv 4E10 heavy chain 9606
475 5O2U 2 B, D VHH 59H10 9844
476 5SV3 1 A, C Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8 9844
477 3NN8 1 A, C, D, G Engineered scFv, heavy chain 10090
478 5OMN 2 C Nanobody (VHH) Nano-27 30538
479 4KRP 2 B Nanobody/VHH domain 9G8 9844
480 1OAX 1 H, J IMMUNOGLOBULIN E FV REGION, RESIDUES 1-122 10090
481 6FUZ 2 N nanobody 9844
482 4FHB 2 D Nb179 9844
483 4DK3 1 A, B single domain antibody VHH 9844
484 4KRL 1 B Nanobody/VHH domain 7D12 9844
485 4V1D 1 A SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN 9606
486 4V1D 4 D SINGLE CHAIN ANTIBODY FRAGMENT RU1, HEAVY CHAIN 9606
487 1BZQ 2 K, L, M, N PROTEIN (ANTIBODY CAB-RN05) VARIABLE DOMAIN 9838
488 1NMA 3 H FAB NC10 RESOLUTION OF 3.0 ANGSTROMS 10090
489 1YZZ 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 9838
490 6MXT 2 N nanobody Nb71 9844
491 4LDE 2 B Camelid Antibody Fragment 9844
492 4Y5Y 1 A, D diabody 330 VH domain 9606
493 6IBL 2 C, D Camelid antibody fragment Nb80 9844
494 5DMJ 2 B, E, G 3H65-5 domain antibody (dAb) 9606
495 1BVL 1 A, C HULYS11 FV 10090
496 6H7L 3 C, D Camelid antibody fragment Nb6B9 9844
497 3RJQ 2 B Llama VHH A12 9844
498 1ZMY 1 A Antibody cabbcII-10:lys3 N-terminus, 142 residues 9838
499 6CF2 1 A Anti-Rev Antibody, heavy chain Fab single-chain variable fragment 9986
500 3AB0 2 B, E antibody ScFv fragment, heavy chain 10090
501 3LHP 1 H, I Fv 4E10 heavy chain 9606
502 5Y7Z 2 C, D NANOBODY 9844
503 4N1H 2 B, D Camelid heavy-chain antibody variable fragment cAb-F11N 9844
504 6CK9 2 D 35O22 scFv heavy chain portion 9606
505 6EQI 2 B Nb696 9844
506 2BSE 2 D, E, F LLAMA IMMUNOGLOBULIN VHH RECOGNITION DOMAIN, RESIDUES 1-123 9844
507 1YC8 1 A, B anti-VSG immunoglobulin heavy chain variable domain cAbAn33 cAbAn33-hu 9838
508 4KFZ 2 C, D Anti-LMO2 VH 9606
509 2UUD 1 H, J NQ10-1.12 ANTI-PHOX ANTIBODY 10090
510 5TOJ 2 D, E, F Single-domain antibody F-VHH-4 9844
511 6H7O 3 C, D Camelid antibody fragment Nb6B9 9844
512 4Y5X 1 A, D, G, J diabody 310 VL domain 9606
513 4YGA 2 B, D, F, H VHH-1B7 30538
514 6MU8 2 D 35O22 scFv heavy chain portion 9606
515 4UT9 2 H, I, J, K BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C10 SCFV, HEAVY CHAIN DOMAIN 9606
516 2A9N 2 H, I fluorescein-scfv heavy chain 9606
517 5GS0 3 D, F heavy chain (anti-TLR3) 10090
518 5GS0 4 H, X heavy chain (anti-Lid) 10090
519 5YY5 2 H Heavy chain 9606
520 5YY5 4 C Heavy chain 9606
521 5G5X 2 B NANOBODY NB330, SELECTED FROM LLAMA, C-TERMINAL 6XHIS- TAG 9844
522 1KYO 10 J, U HEAVY CHAIN (VH) OF FV-FRAGMENT RESIDUES 1-127 10090
523 5GRJ 1 H avelumab H chain 9606
524 4NKD 1 A, C, E, G Engineered scFv heavy chain 10090
525 6MUG 2 D 35O22 scFv heavy chain portion 9606
526 5BOZ 2 G, H, I, J, K, L VHH single chain antibody E1 30538
527 4KRO 2 B Nanobody/VHH domain EgA1 9844
528 3WXV 2 H V region heavy chain 10090
529 4KV5 2 E, G, H, J heavy chain GC1009 scFv 9606
530 3DWT 1 A, B, C, D, E, F, G, H cAbBCII-10 9838
531 5TJW 2 K NP-specific inhibitory VHH 30538
532 1QLE 5 H HEAVY CHAIN ANTIBODY FV FRAGMENT 10090
533 6H7M 3 C, D Camelid antibody fragment Nb6B9 562
534 4LDL 2 B Camelid Antibody Fragment 9844
535 6MUF 2 D 35O22 scFv heavy chain portion 9606
536 4LDO 2 B Camelid Antibody Fragment 9844
537 5XJ3 1 A, D, G, J ipilimumab-VH 9606
538 3SN6 5 N Camelid antibody VHH fragment 9844
539 5M94 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
540 4M8Q 1 A, H GEP1 Fv heavy chain 9606
541 5NHR 2 A, H Bimagrumab Fv heavy-chain VH 9606
542 4W2O 1 A, C, E, G Anti-Marburgvirus Nucleoprotein Single Domain Antibody B 9844
543 5O8F 2 K, O Nanobody Nb25 9844
544 5O8F 3 L, M, N Nanobody Nb25 9844
545 5NQW 2 C, D 026 9844
546 5C3L 4 D Nanobody Nb15 Nanobody 9838
547 5J3H 2 C mAb 83-7 Fab heavy chain 10090
548 5U8R 2 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
549 1G6V 2 K ANTIBODY HEAVY CHAIN CAB-CA05, VARIABLE DOMAIN 9838
550 5UK4 2 a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition mofiv and HIS TAG 30538
551 5FV2 1 A, B, C VH DOMAIN ANTIBODY VH DOMAIN ANTIBODY 9606
552 4WGV 2 B, D Camelid antibody fragment, nanobody 9844
553 6H7J 3 C, D Camelid antibody fragment Nb80 9844
554 5OJM 2 K, L, M, N, O Nanobody Nb25 9844
555 6B73 2 C, D Nanobody 9844
556 4PIR 2 F, G, H, I, J VHH15 9844
557 5XWD 2 H VH chain of 059-152 9606
558 6C5W 2 C, E nanobody 32644
559 4QKX 2 B R9 protein 9844
560 5JQH 2 C, D Nanobody60, Nb60 9844
561 4YBQ 3 D, F antibody Fv fragment heavy chain 10090
562 4PD4 10 J Igh protein 10090
563 6C9W 2 B Nanobody9047 Full 9844
564 5DA0 2 B Nanobody 9844
565 6GCI 2 B Nanobody Nanobody selected against the BKA-inhibited ADP/ATP carrier 9844
566 4R0L 1 A, H Antibody 1C6 Heavy chain 10090
567 5U8Q 3 H Fv 24-60 heavy chain Heavy chain variable domain (residues 1-118) of mAb 24-60, including additional Gly-Thr at the N terminus and Glu-Asn-Leu-Tyr-Phe-Gln at C terminus. 10090
568 3P0G 2 B Camelid Antibody Fragment NANOBODY 9844
569 4ODX 2 A, H GEP7 Fv heavy chain 9606
570 5M95 2 B, D CAMELID ANTIBODY FRAGMENT, NANOBODY 9844
571 4WGW 2 B, D Camelid antibody fragment, nanobody 9844
572 1RVF 6 H FAB 17-IA 10090
573 5JZ7 2 C, G, H, J MEDI578 scFv, heavy chain 9606
574 5IHL 2 B, E, G, I 3H56-5 domain antibody (dAb) 3H56-5 dAb 9606
575 4MQS 2 B Nanobody 9-8 9844
576 5DHY 1 A, H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
577 5WB2 3 D nanobody B1 32630
578 1QFW 4 H ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) FV 10090
579 1QFW 6 I ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) FV 10090
580 3K81 2 A, B Single strand antibody VHH domain single domain antibody VHH 9844
581 4OGA 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
582 4MQT 2 B Nanobody 9-8 9844
583 5TOK 2 D, E, F Single-domain antibody F-VHH-L66 9844
584 4NKM 1 A, C, E, G Engineered scFv heavy chain 10090
585 6CNV 3 C SD84h 32630
586 3W11 3 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
587 4NKO 2 B, D, F Engineered scFv heavy chain 10090
588 5EUL 4 V AYC08 30538
589 5GXB 2 B nanobody 30538
590 5NBD 2 C Nanobody 9844
591 3W13 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
592 3W12 2 C monoclonal antibody fab 83-7 fragment - heavy chain 10090
593 5H8O 1 A VHH nanobody 9844
594 4KSD 2 B R2 protein 9844
595 5DHZ 1 H Anti-Rev Antibody Fab single-chain variable fragment, heavy chain 9986
596 2A0L 3 D, F 33H1 Fv fragment Fv fragment, heavy chain 10090
597 5DFZ 4 E Nanobody binding S. cerevisiae Vps34 9844
598 5UKB 1 a, b, c, d, e Anti-vesicular stomatitis virus N VHH GGLPETGGHHHHHH Sortase A recognition motif and HIS tag. 30538
599 5WDU 2 D, O, W bnAb NIH45-46 scFv heavy chain 9606
600 5TD8 5 E nanobody 30538
601 6I53 4 G Megabody38 9844
602 6MID 3 H monoclonal antibody ZIKV-195 heavy chain Fab variable domain 9606
603 6MF7 2 H antibody 860-55D heavy chain Fab 9606
604 6AJ7 2 H VH of Fab 15C5 10090
605 6AJ9 2 D VH of Fab 11G1 10090
606 6AJ9 4 H VH of Fab 15C5 10090
607 6AD0 2 H VH of Fab 2G8 10090
608 6E3Y 2 N Nanobody 35 9844
609 6A96 1 K, L, O Nb25 9844
610 6DZL 4 G, H, I Fv domain of ADI-15878 Fab heavy chain 9606
611 6DZM 4 G, I, J Antibody ADI-15878 Fab, heavy chain 9606
612 6GV4 5 H AT12-015 antibody variable heavy polypeptide chain 9606
613 6CUE 3 3, H, h vFP7.04 Heavy chain 10090
614 6CUE 5 5, M, m PGT122 heavy Chain 9606
615 6CUE 7 7, Q, q VRC03 Heavy chain 9606
616 6CUF 3 5, M, m PGT122 Heavy chain 9606
617 6CUF 6 8, Q, q VRC03 heavy chain 9606
618 6CDI 4 5, M, m PGT122 Heavy Chain 9606
619 6BSP 1 A U4 Heavy chain 10090
620 6B3J 6 N Nanobody 35 9844
621 6EHG 3 C hC3Nb1 9844
622 5Y0A 2 D, F, H variable region of Fab ZKA190 heavy chain 9606
623 5XS7 2 H Heavy chain of Fab 1D5 10090
624 5W3L 5 E C5 antibody variable heavy domain 10090
625 5W3M 1 E C5 antibody variable heavy domain 10090
626 5W3O 1 D C5 antibody variable heavy domain 10090
627 5W3E 1 E C5 antibody variable heavy domain 10090
628 5VAI 6 N nanobody 35 9844
629 5UZ7 4 N NANOBODY 35 9844
630 5TSJ 10 1, 2 Human heavy chain domain antibody 9606
631 5TR1 2 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
632 5TQQ 3 H, I Monoclonal antibody, Fab fragment, heavy chain 10090
633 5H32 2 G, I, K C10 IgG heavy chain variable region 9606
634 5H37 3 G, I, K C10 IgG heavy chain variable region 9606
635 5H30 3 G, I, K IgG C10 heavy chain 9606
636 5KWL 4 7 VHH 10E 9838
637 5KTZ 4 7 VHH 12B 9838
638 5KU0 4 7 VHH 17B 9838
639 5KU2 4 7 VHH 7A 9838
640 5KEL 3 H, P, Q c2G4 variable Fab domain heavy chain 9606
641 5KEL 5 C, J, M c13C6 variable Fab domain heavy chain 9606
642 5KEM 2 B, G BDBV91 variable Fab domain heavy chain 9606
643 5KEM 3 D, I c13C6 variable Fab domain heavy chain 9606
644 5KEN 3 C, G, N c4G7 variable Fab domain heavy chain 9606
645 5KEN 6 J, Q c13C6 variable Fab domain heavy chain 9606
646 3JCX 2 H Fab E heavy chain 10116
647 5FOJ 1 A NANOBODY 9838
648 3JBC 5 7 nanobody VHH PVSP29F 9838
649 3JBD 5 7 nanobody VHH PVSP6A 9838
650 3JBE 5 7 nanobody VHH PVSS8A 9838
651 3JBF 5 7 nanobody VHH PVSP19B 9838
652 3JBG 5 7 nanobody VHH PVSS21E 9838
653 3JBA 2 H H16.U4 antibody heavy chain Fab variable domain 10090
654 3JAU 2 H Heavy chain of Fab fragment variable region of antibody D5 10090
655 5A1Z 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 180 COPIES OF FAB 2D22 MOLECULE BIND TO VIRUS SURFACE 9606
656 4UIF 3 G, I, K ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 - HEAVY CHAIN 9606
657 4UIH 2 D, F ANTIGEN-BINDING FRAGMENT OF HUMAN ANTIBODY 2D22 -HEAVY CHAIN 9606
658 4UDF 4 11, 15, 19, 1D, 1H, 1L, 1P, 1T, 1X, 21, 25, 29, 2D, 2H, 2L, 2P, 2T, 2X, 31, 35, 39, 3D, 3H, 3L, 3P, 3T, 3X, 41, 45, 49, 4D, 4H, 4L, 4P, 4T, 4X, 51, 55, 59, 5D, 5H, 5L, 5P, 5T, 5X, 61, 65, 69, 6D, 6H, 6L, 6P, 6T, 6X, 7D, 7H, 7L, 7P, 7T, 7X HUMAN MONOCLONAL ANTIBODY 9606
659 3J8Z 3 F, G, H, I H16.1A heavy chain variable domain Fab 10090
660 3J8V 3 F, G, H, I H16.14J heavy chain variable domain Fab 10090
661 3J8W 2 F, G, H, I H263.A2 heavy chain variable domain Fab 10090
662 3J7E 2 B, D, F, H H16.V5 Fab heavy chain variable domain 10090
663 3J6U 3 H Fab 5J7 heavy chain variable region 9606
664 4CKD 2 H, I, J, K SCFV13R4 ANTIBODY FV HEAVY CHAIN 10090
665 3IY1 2 B Fab B, heavy chain 10116
666 3IY2 2 B Antibody 6, heavy chain FRAGMENT OF ANTIBODY 6 10090
667 3IY3 2 B antibody fragment from neutralizing antibody 8 (heavy chain) 10090
668 3IY4 2 B fragment of neutralizing antibody 15 (heavy chain) 10090
669 3IY5 2 B antibody fragment IGG2A (heavy chain) 10090
670 3IY6 2 B fragment from neutralizing antibody E (heavy chain) 10116
671 3IY7 2 B fragment from neutralizing antibody F (heavy chain) 10116
672 3IY0 2 H Fab 14, heavy domain 10090
673 1IEH 1 A BRUC.D4.4 SINGLE DOMAIN ANTIBODY FROM A NAIVE LLAMA LIBRARY 9844
674 1G9E 1 A H14 9844
675 1QNZ 1 H 0.5B ANTIBODY (HEAVY CHAIN) FV 10090
676 1VHP 1 A VH-P8 9606