Sequence Similarity Clusters for the Entities in PDB 1GGW

Entity #1 | Chains: A
PROTEIN (CDC4P) protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 60042
95 % 1 1 49106
90 % 1 1 46561
70 % 1 1 40837
50 % 1 1 34655
40 % 361 372 47
30 % 437 451 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4YI8 1 A Recoverin 9913
7 4YI9 1 A Recoverin 9913
8 4DJC 1 A Calmodulin 9606
9 3GOF 1 A, B Calmodulin 9031
10 3GP2 1 A Calmodulin 9031
11 4LZX 1 A Calmodulin UNP residues 2-149 9606
12 2W73 1 A, B, E, F CALMODULIN 9606
13 2F3Y 1 A Calmodulin 9606
14 4MLW 1 A Recoverin 9913
15 5DOW 1 A, C, E, G Calmodulin 9606
16 4M2P 1 A Recoverin 9913
17 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
18 4M2O 1 A Recoverin 9913
19 4J9Y 2 R Calmodulin 10116
20 5G08 1 A FREQUENIN 2 7227
21 2O60 1 A Calmodulin 9031
22 5AAN 1 A CG5907-PA, ISOFORM A 7227
23 5V03 2 R Calmodulin 9606
24 3IF7 1 A Calmodulin 9913
25 4F0Z 2 B Calcineurin subunit B type 1 Calcineurin B Subunit 9606 3.1.3.16 | Details
26 6DAD 1 A, B Calmodulin-1 9606
27 5NIN 1 A, B Calmodulin 9606
28 1QTX 1 A PROTEIN (CALMODULIN) 562
29 4G28 2 R Calmodulin 10116
30 1OMR 1 A recoverin 9913
31 4G27 2 R Calmodulin 10116
32 1M45 1 A Myosin light chain 4932
33 1G4Y 2 R CALMODULIN 10116
34 4J9Z 2 R Calmodulin 10116
35 2F3Z 1 A Calmodulin 9606
36 1PRW 1 A Calmodulin 9913
37 1OSA 1 A CALMODULIN 5888
38 5JQA 1 A Calmodulin 9606
39 1MXE 1 A, B Calmodulin 7227
40 1NCX 1 A TROPONIN C 9031
41 1TOP 1 A TROPONIN C 9031
42 5B8I 2 B Calcineurin subunit B, variant 5501
43 1YR5 1 A calmodulin residues 1-148 9606
44 5JTH 1 A Calmodulin 9606
45 1CLL 1 A CALMODULIN 9606
46 4GUK 1 A, B, C, D Neuronal calcium sensor 1 9606
47 5V02 2 R Calmodulin-1 9606
48 1NCZ 1 A TROPONIN C 9031
49 2WEL 2 D CALMODULIN 9606
50 6EPA 1 A FI18190p1 7227
51 1N0Y 1 A, B Calmodulin 5888
52 3BYA 1 A Calmodulin 9606
53 1VRK 1 A CALMODULIN 32630
54 3SJQ 1 A, B Calmodulin 10116
55 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
56 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
57 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
58 1NCY 1 A TROPONIN C 9031
59 5K8Q 1 A Calmodulin 9606
60 4EHQ 1 A Calmodulin 10116
61 1CLM 1 A CALMODULIN 5888
62 5TNC 1 A TROPONIN-C 9103
63 4BW7 1 A, C CALMODULIN 9606
64 1AHR 1 A CALMODULIN 9031
65 1IQ5 1 A CALMODULIN 8355
66 5WBX 2 R Calmodulin-1 9606
67 4M2Q 1 A Recoverin 9913
68 1REC 1 A RECOVERIN 9913
69 1CM4 1 A CALMODULIN 9913
70 1ZUZ 1 A calmodulin 9606
71 4TNC 1 A TROPONIN C 9031
72 1QS7 1 A, C CALMODULIN 562
73 5FYX 1 A FREQUENIN 2 7227
74 2Y4V 1 A CALMODULIN 9606
75 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
76 3LL8 3 B, D Calcineurin subunit B type 1 UNP residues 16-170 9606
77 6DAE 1 A, B Calmodulin-1 9606
78 2HQW 1 A Calmodulin 10116
79 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
80 3SUI 1 A Calmodulin 9606
81 1UP5 1 A, B Calmodulin 9031
82 4BW8 1 A, B CALMODULIN 9606
83 3WFN 1 B, C, D, E Calmodulin, Sodium channel protein type 8 subunit alpha CHIMERA PROTEIN OF CALMODULIN (UNIPROT P62204 CALM_MOUSE) AND NAV1.6 IQ MOTIF FROM SODIUM CHANNEL PROTEIN TYPE 8 SUBUNIT ALPHA (UNIPROT Q9WTU3 SCN8A_MOUSE, RESIDUES 1893-1914) 10090
84 4QNH 2 R Calmodulin 10116
85 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
86 1G8I 1 A, B NEURONAL CALCIUM SENSOR 1 9606
87 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
88 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
89 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
90 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
91 4Q5U 1 A Calmodulin 9606
92 4AQR 1 A, B CALMODULIN-7 3702
93 2BE6 1 A, B, C Calmodulin 2 9606
94 1S6C 1 A Kv4 potassium channel-interacting protein KChIP1b Core domain (Residues 34-216) 10116
95 1N2D 1 A, B Myosin Light Chain 4932
96 1CDL 1 A, B, C, D CALMODULIN 9606
97 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
98 4DBP 2 C Calmodulin 7227
99 1AUI 2 B SERINE/THREONINE PHOSPHATASE 2B 9606 3.1.3.16 | Details
100 4HEX 1 A, B Calmodulin 10090
101 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
102 4M1L 1 A Calmodulin UNP residues 2-149 9606
103 5AEQ 1 A, B NEURONAL CALCIUM SENSOR 1 10116
104 1OMV 1 A recoverin 9913
105 2BCX 1 A Calmodulin 9031
106 1LIN 1 A CALMODULIN 9913
107 3CLN 1 A CALMODULIN 10117
108 1IWQ 1 A CALMODULIN 9606
109 1M46 1 A Myosin light chain 4932
110 2V01 1 A CALMODULIN 9606
111 1WRZ 1 A calmodulin 9606
112 2YGG 2 B CALMODULIN 10116
113 1UHN 1 A calcineurin B-like protein 2 residues 32-220 3702
114 1RFJ 1 A calmodulin 4113
115 5W1A 2 B, D Myosin light chain alkali 7227
116 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
117 3L9I 2 C Calmodulin 7227
118 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
119 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
120 1CM1 1 A CALMODULIN 9913
121 4DS7 1 A, B, C, D Calmodulin 28985
122 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
123 2D8N 1 A Recoverin 9606
124 1NIW 1 A, C, E, G calmodulin 10116
125 4OR9 2 B Calcineurin subunit B type 1 regulatory subunit 9606
126 2EHB 1 A Calcineurin B-like protein 4 residues in database 1-207 3702
127 4CLN 1 A CALMODULIN 7227
128 3G43 1 A, B, C, D Calmodulin 9606
129 6CZQ 2 R Calmodulin-1 residues 5-148 10116
130 3PN7 2 B, E Myosin regulatory light chain 6577
131 3PN7 3 C, F Myosin essential light chain 6577
132 1XA5 1 A Calmodulin 9913
133 1OOJ 1 A Calmodulin CMD-1 6239
134 2X0G 2 B CALMODULIN 9606
135 1DTL 1 A CARDIAC TROPONIN C 9031
136 2F2O 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
137 1TCF 1 A TROPONIN C 9986
138 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
139 6B8P 2 B, D, F, H Calmodulin-1 9606
140 4DCK 2 B Calmodulin Calmodulin 9606
141 2P6B 3 B, D Calcineurin subunit B isoform 1 Residues 16-170 9606
142 4PJJ 2 B Calmodulin 7227
143 4L79 2 B Calmodulin 9606
144 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
145 6HCS 1 A, C, E, G Calmodulin-1 9606
146 5WC5 2 R Calmodulin-1 9606
147 4BY5 1 A, B, C, D FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
148 5AER 1 A NEURONAL CALCIUM SENSOR 1 10116
149 2CT9 1 A, B Calcium-binding protein p22 10116
150 2X51 2 B CALMODULIN 7227
151 6B8N 2 B, D, F, H Calmodulin-1 9606
152 6B8L 2 B, D, F, H Calmodulin-1 9606
153 2GGM 1 A, B Centrin-2 9606
154 3BXL 1 A Calmodulin 10116
155 5OTJ 3 C, D Polcalcin Phl p 7 15957
156 3TS5 2 B, E Myosin regulatory light chain 6577
157 3TS5 3 C, F Myosin essential light chain 6577
158 2VB6 2 B CALMODULIN 9031
159 5DBR 1 A Calmodulin 9606
160 4BY4 1 A, B FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
161 3DVE 1 A Calmodulin 9606
162 1A2X 1 A TROPONIN C 9986
163 4DBQ 2 B Calmodulin 7227
164 6DAF 1 A, B Calmodulin-1 9606
165 3FWB 1 A Cell division control protein 31 4932
166 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
167 2BKH 2 B CALMODULIN 7227
168 2V02 1 A CALMODULIN 9606
169 5AFP 1 A, B NEURONAL CALCIUM SENSOR 1 10116
170 6B8M 2 B, D, F, H Calmodulin-1 9606
171 1TCO 2 B SERINE/THREONINE PHOSPHATASE B2 CHAIN A IS THE CATALYTIC SUBUNIT, RESIDUES 18 -392. CHAIN B IS THE REGULATORY SUBUNIT, RESIDUES 1 - 169 9913 3.1.3.16 | Details
172 1QIW 1 A, B CALMODULIN 9913
173 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
174 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
175 4ZLK 2 B Calmodulin 10090
176 3TUY 2 B, E Myosin regulatory light chain 6577
177 3TUY 3 C, F Myosin essential light chain 6577
178 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
179 1BJF 1 A, B NEUROCALCIN DELTA 9913
180 3EWT 1 A Calmodulin 9606
181 2VAS 2 B CALMODULIN 7227
182 1Y6W 1 A Calmodulin 9606
183 5SVE 2 B Calcineurin subunit B type 1 9606
184 1CTR 1 A CALMODULIN 9606
185 1L7Z 1 A CALMODULIN 9606
186 5G4P 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
187 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
188 4BYF 2 B, D CALMODULIN 9606
189 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
190 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
191 4MBE 1 A, D Cell division control protein 31 4932
192 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
193 6DAH 1 A, B, C, D Calmodulin-1 9606
194 3DVK 1 A Calmodulin 9606
195 5G58 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
196 3BXK 1 A, C Calmodulin 10116
197 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
198 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
199 1QIV 1 A CALMODULIN 9913
200 1A29 1 A CALMODULIN 9913
201 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
202 2FOT 1 A Calmodulin 9913
203 3HR4 2 B, D, F, H Calmodulin 9606
204 4ORA 2 B Calcineurin subunit B type 1 9606
205 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
206 4OV2 1 A, B, C, D Neuronal calcium sensor 1 C-terminal truncation (UNP residues 1-177) 10116
207 3QRX 1 A Centrin 3055
208 6B8Q 2 B, D, F, H Calmodulin-1 9606
209 3GN4 2 B, D, F, H Calmodulin 7227
210 3FWC 1 A, E, I, M Cell division control protein 31 4932
211 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
212 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
213 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
214 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
215 3EWV 1 A Calmodulin 9606
216 4ORC 2 B Calcineurin subunit B type 1 regulatory subunit 9606
217 2BEC 1 A Calcineurin B homologous protein 2 9606
218 3OXQ 1 A, B, C, D Calmodulin 9606
219 1K90 2 D, E, F CALMODULIN 9606
220 4GOW 1 D Calmodulin 9606
221 2F2P 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
222 4ANJ 2 B CALMODULIN 7227
223 4OVN 1 A, B, C, D, E Calmodulin 9606
224 5HIT 1 A Calmodulin 9031
225 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
226 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
227 1V1G 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
228 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
229 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
230 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
231 4E50 1 A Calmodulin, Linker, IQ motif of Neurogranin chimera of Calmodulin, Linker, IQ motif of Neurogranin 10090
232 5V7X 2 B Calmodulin-1 9606
233 5I0I 2 C Calmodulin 9606
234 5I0I 3 E Calmodulin 9606
235 4ORB 2 B Calcineurin subunit B type 1 regulatory subunit 10090
236 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
237 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
238 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
239 1J1D 1 A, D Troponin C 9606
240 4UMO 2 C, D CALMODULIN 9606
241 4JPZ 3 C, I Calmodulin 9606
242 1DEG 1 A CALMODULIN 9913
243 5M6C 1 A Neuron-specific calcium-binding protein hippocalcin 9606
244 5M6C 2 E Neuron-specific calcium-binding protein hippocalcin 9606
245 4YRU 1 A, B, C, D Neuronal calcium sensor 1 UNP residues 1-177 10116
246 3DVJ 1 A Calmodulin 9606
247 3DVM 1 A Calmodulin 9606
248 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
249 1M63 2 B, F CALCINEURIN B SUBUNIT ISOFORM 1 9606
250 2HET 1 A, B, C, D Recoverin 9913
251 1V1F 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
252 4E53 1 A, B Calmodulin, Linker, IQ motif of Neuromodulin chimera of Calmodulin, Linker, IQ motif of Neuromodulin 10090
253 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
254 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
255 4WPX 1 A, D Cell division control protein 31-like protein 209285
256 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
257 2BKI 2 B, D CALMODULIN 9031
258 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
259 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
260 2GV5 1 A, B, D, E Cell division control protein 31 4932
261 5D43 1 A, B Centrin-1 10090
262 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
263 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
264 2DOQ 1 A, B, C Cell division control protein 31 4932
265 1MF8 2 B CALCINEURIN B SUBUNIT ISOFORM 1 9606 3.1.3.16 | Details
266 1S26 2 D, E, F Calmodulin 9606
267 1SK6 2 D, E, F Calmodulin 9606
268 1K93 2 D, E, F CALMODULIN 9606
269 2I2R 2 E, F, G, H, M, N, O, P Kv channel-interacting protein 1 conserved structural core (residues 37-216) 9606
270 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
271 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
272 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
273 1J1E 1 A, D Troponin C 9606
274 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
275 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
276 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
277 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
278 2NZ0 1 A, C Kv channel-interacting protein 1 N-terminal deletion domain 9606
279 2OTG 2 B Myosin regulatory light chain 6577
280 2OTG 3 C Myosin essential light chain 6577
281 1YTZ 3 C Troponin C 9031
282 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
283 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
284 4R8G 2 A, B, H Calmodulin 8355
285 1PK0 2 D, E, F Calmodulin 9606
286 1QX7 1 A, B, I, M, R Calmodulin 10116
287 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
288 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
289 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
290 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
291 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
292 2EC6 3 C Myosin essential light chain 6577
293 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
294 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
295 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
296 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
297 2OS8 3 C Myosin essential light chain Myosin ELC 6577
298 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
299 4JQ0 2 C Calmodulin 9606
300 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
301 1LVC 2 D, E, F calmodulin 9606
302 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
303 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
304 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
305 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
306 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
307 1YV0 3 C Troponin C, skeletal muscle 9031
308 6MV3 1 A Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle chimera 9606
309 6E2F 2 E Calmodulin-1 9606
310 6E2G 2 E Calmodulin-1 9606
311 6DMW 2 E Calmodulin-1 10116
312 6GDK 1 A Calmodulin-1 9606
313 6GDL 1 A Calmodulin-1 9606
314 6CNM 2 E, F, G, H Calmodulin-1 9606
315 6CNN 2 E, F, G, H Calmodulin-1 9606
316 6CNO 2 E, F, G, H Calmodulin-1 9606
317 6C1D 3 R Calmodulin 32644
318 6C1G 2 R Calmodulin 32644
319 6C1H 3 R Calmodulin 32644
320 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
321 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
322 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
323 5OEO 1 A Calmodulin-1 9606
324 5WCL 1 A Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle 9606
325 5W88 1 A Troponin C, Troponin I unp residues 1-90; 138-163 9606
326 5VMS 2 B Calmodulin 9606
327 5VLN 1 A Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle 9606
328 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
329 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
330 5TP5 1 A Calmodulin 9606
331 5TP6 1 A Calmodulin 9606
332 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
333 5T7C 1 A Hippocalcin-like protein 1 Myristoyl group is covalently attached to the N-terminal 9606
334 5T0X 1 A Calmodulin 8355
335 5SY1 1 C, D Calmodulin 7108
336 5GGM 1 A Calmodulin 9606
337 5B7X 1 A Calmodulin, putative 5759
338 5K7L 2 B Calmodulin 9606
339 5J8H 1 A Calmodulin 9606
340 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
341 2N8J 1 A Calmodulin 9606
342 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
343 2N6A 1 A human calmodulin/connexin-36 peptide hybrid 9606
344 3JAX 2 C, D smooth muscle myosin essential light chain 6183
345 2N27 1 A Calmodulin UNP residues 2-149 9606
346 2MGU 1 A Calmodulin 10116
347 2MG5 1 A Calmodulin UNP residues 2-149 9606
348 2MES 1 A Calmodulin 8355
349 3J41 2 E, F Calmodulin 9606
350 2M55 1 A Calmodulin 9606
351 2M3S 1 A Calmodulin UNP residues 1-149 9031
352 2M28 1 A Calcium-binding protein 4 10090
353 2M29 1 A Calcium-binding protein 4 10090
354 2M0J 1 A Calmodulin 9606
355 2M0K 1 A Calmodulin 9606
356 2LV6 1 A Calmodulin 9606
357 2LMT 1 A Calmodulin-related protein 97A 7227
358 2LMU 1 A Calmodulin-related protein 97A 7227
359 2LMV 1 A Calmodulin-related protein 97A 7227
360 2LL6 1 A Calmodulin 9606
361 2LL7 1 A Calmodulin 9606
362 2LHH 1 A Calmodulin UNP RESIDUES 2-121 4932
363 2LHI 1 A Calmodulin, Serine/threonine-protein phosphatase 2B catalytic subunit A1 THE FUSION PROTEIN OF CALMODULIN (RESIDUE 1-146), LINKER (GSSTG) AND CALCINEURIN A1 (RESIDUES 453-476) 32630
364 2LGF 1 A Calmodulin sequence database residues 4-149 9606
365 2LCP 1 A Neuronal calcium sensor 1 9606
366 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
367 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
368 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
369 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
370 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
371 2L7L 1 A Calmodulin 9606
372 2L53 1 A Calmodulin calmodulin 9606
373 2L2E 1 A Calcium-binding protein NCS-1 4896
374 2L1W 1 A Calmodulin 3847
375 2KNE 1 A Calmodulin 9606
376 2KDU 1 A Calmodulin 8355
377 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
378 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
379 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
380 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
381 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
382 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
383 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
384 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
385 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
386 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
387 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
388 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
389 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
390 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
391 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
392 2K61 1 A Calmodulin 9606
393 2K0J 1 A calmodulin 9606
394 2K0E 1 A Calmodulin 9606
395 2K0F 1 A calmodulin 9606
396 2JZI 1 A Calmodulin 9606
397 2JU0 1 A Calcium-binding protein NCS-1 4932
398 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
399 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
400 2JT3 1 A Troponin C 9606
401 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
402 2JNF 1 A Troponin C 212017
403 2E30 1 A Calcium-binding protein p22 9606
404 2I94 1 A Recoverin 9913
405 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
406 1X02 1 A calmodulin 8355
407 1SY9 1 A CALMODULIN 8355
408 1S6I 1 A Calcium-dependent protein kinase SK5 Calmodulin-like domain (CLD) and C-terminal tail 3847 2.7.11.1 | Details
409 1NWD 1 A Calmodulin 8355
410 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
411 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
412 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
413 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
414 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
415 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
416 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
417 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
418 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
419 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
420 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
421 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
422 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
423 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
424 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
425 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
426 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
427 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
428 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
429 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
430 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
431 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
432 1LKJ 1 A Calmodulin 4932
433 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
434 1LA3 1 A Recoverin 9913
435 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
436 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
437 1GGW 1 A PROTEIN (CDC4P) 4896
438 1FPW 1 A CALCIUM-BINDING PROTEIN NCS-1 4932
439 1CFF 1 A CALMODULIN 8355
440 1CKK 1 A Calmodulin-1 8355
441 1MUX 1 A CALMODULIN 8355
442 1JSA 1 A RECOVERIN 9913
443 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
444 1DMO 1 A CALMODULIN 8355
445 1IKU 1 A RECOVERIN 9913
446 1CFD 1 A CALMODULIN 8355
447 1TNW 1 A TROPONIN C 9031
448 1TNX 1 A TROPONIN C 9031
449 1CFC 1 A CALMODULIN 8355
450 2BBM 1 A CALMODULIN 7227
451 2BBN 1 A CALMODULIN 7227