Sequence Similarity Clusters for the Entities in PDB 1GGW

Entity #1 | Chains: A
PROTEIN (CDC4P) protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 58887
95 % 1 1 48157
90 % 1 1 45696
70 % 1 1 40111
50 % 1 1 34011
40 % 354 365 48
30 % 424 438 43

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4YI8 1 A Recoverin 9913
7 4YI9 1 A Recoverin 9913
8 4DJC 1 A Calmodulin 9606
9 3GOF 1 A, B Calmodulin 9031
10 3GP2 1 A Calmodulin 9031
11 4LZX 1 A Calmodulin UNP residues 2-149 9606
12 2W73 1 A, B, E, F CALMODULIN 9606
13 2F3Y 1 A Calmodulin 9606
14 4MLW 1 A Recoverin 9913
15 5DOW 1 A, C, E, G Calmodulin 9606
16 4M2P 1 A Recoverin 9913
17 1GGZ 1 A CALMODULIN-RELATED PROTEIN NB-1 9606
18 4M2O 1 A Recoverin 9913
19 4J9Y 2 R Calmodulin 10116
20 5G08 1 A FREQUENIN 2 7227
21 2O60 1 A Calmodulin 9031
22 5AAN 1 A CG5907-PA, ISOFORM A 7227
23 5V03 2 R Calmodulin 9606
24 3IF7 1 A Calmodulin 9913
25 4F0Z 2 B Calcineurin subunit B type 1 Calcineurin B Subunit 9606 3.1.3.16 | Details
26 5NIN 1 A, B Calmodulin 9606
27 1QTX 1 A PROTEIN (CALMODULIN) 562
28 4G28 2 R Calmodulin 10116
29 1OMR 1 A recoverin 9913
30 4G27 2 R Calmodulin 10116
31 1M45 1 A Myosin light chain 4932
32 1G4Y 2 R CALMODULIN 10116
33 4J9Z 2 R Calmodulin 10116
34 2F3Z 1 A Calmodulin 9606
35 1PRW 1 A Calmodulin 9913
36 1OSA 1 A CALMODULIN 5888
37 5JQA 1 A Calmodulin 9606
38 1MXE 1 A, B Calmodulin 7227
39 1NCX 1 A TROPONIN C 9031
40 1TOP 1 A TROPONIN C 9031
41 5B8I 2 B Calcineurin subunit B, variant 5501
42 1YR5 1 A calmodulin residues 1-148 9606
43 5JTH 1 A Calmodulin 9606
44 1CLL 1 A CALMODULIN 9606
45 4GUK 1 A, B, C, D Neuronal calcium sensor 1 9606
46 5V02 2 R Calmodulin-1 9606
47 1NCZ 1 A TROPONIN C 9031
48 2WEL 2 D CALMODULIN 9606
49 6EPA 1 A FI18190p1 7227
50 1N0Y 1 A, B Calmodulin 5888
51 3BYA 1 A Calmodulin 9606
52 1VRK 1 A CALMODULIN 32630
53 3SJQ 1 A, B Calmodulin 10116
54 2OBH 1 A, B Centrin-2 HsCen2 ( Residues: 26-168) 9606
55 2BL0 2 B MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 1-145 5791 3.6.4.1 | Details
56 2BL0 3 C MYOSIN REGULATORY LIGHT CHAIN REGULATORY DOMAIN, RESIDUES 14-155 5791 3.6.4.1 | Details
57 1NCY 1 A TROPONIN C 9031
58 5K8Q 1 A Calmodulin 9606
59 4EHQ 1 A Calmodulin 10116
60 1CLM 1 A CALMODULIN 5888
61 5TNC 1 A TROPONIN-C 9103
62 4BW7 1 A, C CALMODULIN 9606
63 1AHR 1 A CALMODULIN 9031
64 1IQ5 1 A CALMODULIN 8355
65 5WBX 2 R Calmodulin-1 9606
66 4M2Q 1 A Recoverin 9913
67 1REC 1 A RECOVERIN 9913
68 1CM4 1 A CALMODULIN 9913
69 1ZUZ 1 A calmodulin 9606
70 4TNC 1 A TROPONIN C 9031
71 1QS7 1 A, C CALMODULIN 562
72 5FYX 1 A FREQUENIN 2 7227
73 2Y4V 1 A CALMODULIN 9606
74 1TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
75 3LL8 3 B, D Calcineurin subunit B type 1 UNP residues 16-170 9606
76 2HQW 1 A Calmodulin 10116
77 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
78 3SUI 1 A Calmodulin 9606
79 1UP5 1 A, B Calmodulin 9031
80 4BW8 1 A, B CALMODULIN 9606
81 3WFN 1 B, C, D, E Calmodulin, Sodium channel protein type 8 subunit alpha CHIMERA PROTEIN OF CALMODULIN (UNIPROT P62204 CALM_MOUSE) AND NAV1.6 IQ MOTIF FROM SODIUM CHANNEL PROTEIN TYPE 8 SUBUNIT ALPHA (UNIPROT Q9WTU3 SCN8A_MOUSE, RESIDUES 1893-1914) 10090
82 4QNH 2 R Calmodulin 10116
83 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
84 1G8I 1 A, B NEURONAL CALCIUM SENSOR 1 9606
85 1WDC 2 B SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
86 1WDC 3 C SCALLOP MYOSIN PH 7.0 PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN 31199
87 1W7J 2 B MYOSIN LIGHT CHAIN 1 RESIDUES 59-208 9606
88 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
89 4Q5U 1 A Calmodulin 9606
90 4AQR 1 A, B CALMODULIN-7 3702
91 2BE6 1 A, B, C Calmodulin 2 9606
92 1S6C 1 A Kv4 potassium channel-interacting protein KChIP1b Core domain (Residues 34-216) 10116
93 1N2D 1 A, B Myosin Light Chain 4932
94 1CDL 1 A, B, C, D CALMODULIN 9606
95 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
96 4DBP 2 C Calmodulin 7227
97 1AUI 2 B SERINE/THREONINE PHOSPHATASE 2B 9606 3.1.3.16 | Details
98 4HEX 1 A, B Calmodulin 10090
99 2TN4 1 A TROPONIN C RABBIT SKELETAL TROPONIN C 9986
100 4M1L 1 A Calmodulin UNP residues 2-149 9606
101 5AEQ 1 A, B NEURONAL CALCIUM SENSOR 1 10116
102 1OMV 1 A recoverin 9913
103 2BCX 1 A Calmodulin 9031
104 1LIN 1 A CALMODULIN 9913
105 3CLN 1 A CALMODULIN 10117
106 1IWQ 1 A CALMODULIN 9606
107 1M46 1 A Myosin light chain 4932
108 2V01 1 A CALMODULIN 9606
109 1WRZ 1 A calmodulin 9606
110 2YGG 2 B CALMODULIN 10116
111 1UHN 1 A calcineurin B-like protein 2 residues 32-220 3702
112 1RFJ 1 A calmodulin 4113
113 5W1A 2 B, D Myosin light chain alkali 7227
114 4Y99 1 A Troponin C, slow skeletal and cardiac muscles 9606
115 3L9I 2 C Calmodulin 7227
116 3JVT 2 B Myosin regulatory light chain, striated adductor muscle 31199
117 3JVT 3 C Myosin essential light chain, striated adductor muscle 31199
118 1CM1 1 A CALMODULIN 9913
119 4DS7 1 A, B, C, D Calmodulin 28985
120 1OE9 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
121 2D8N 1 A Recoverin 9606
122 1NIW 1 A, C, E, G calmodulin 10116
123 4OR9 2 B Calcineurin subunit B type 1 regulatory subunit 9606
124 2EHB 1 A Calcineurin B-like protein 4 residues in database 1-207 3702
125 4CLN 1 A CALMODULIN 7227
126 3G43 1 A, B, C, D Calmodulin 9606
127 6CZQ 2 R Calmodulin-1 residues 5-148 10116
128 3PN7 2 B, E Myosin regulatory light chain 6577
129 3PN7 3 C, F Myosin essential light chain 6577
130 1XA5 1 A Calmodulin 9913
131 1OOJ 1 A Calmodulin CMD-1 6239
132 2X0G 2 B CALMODULIN 9606
133 1DTL 1 A CARDIAC TROPONIN C 9031
134 2F2O 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
135 1TCF 1 A TROPONIN C 9986
136 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
137 6B8P 2 B, D, F, H Calmodulin-1 9606
138 4DCK 2 B Calmodulin Calmodulin 9606
139 2P6B 3 B, D Calcineurin subunit B isoform 1 Residues 16-170 9606
140 4PJJ 2 B Calmodulin 7227
141 4L79 2 B Calmodulin 9606
142 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
143 5WC5 2 R Calmodulin-1 9606
144 4BY5 1 A, B, C, D FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
145 5AER 1 A NEURONAL CALCIUM SENSOR 1 10116
146 2CT9 1 A, B Calcium-binding protein p22 10116
147 2X51 2 B CALMODULIN 7227
148 6B8N 2 B, D, F, H Calmodulin-1 9606
149 6B8L 2 B, D, F, H Calmodulin-1 9606
150 2GGM 1 A, B Centrin-2 9606
151 3BXL 1 A Calmodulin 10116
152 5OTJ 3 C, D Polcalcin Phl p 7 15957
153 3TS5 2 B, E Myosin regulatory light chain 6577
154 3TS5 3 C, F Myosin essential light chain 6577
155 2VB6 2 B CALMODULIN 9031
156 5DBR 1 A Calmodulin 9606
157 4BY4 1 A, B FI18190P1 CALCIUM BINDING TO EF HANDS 2,3 AND 4 7227
158 3DVE 1 A Calmodulin 9606
159 1A2X 1 A TROPONIN C 9986
160 4DBQ 2 B Calmodulin 7227
161 3FWB 1 A Cell division control protein 31 4932
162 6ALE 2 R Calmodulin-2 UNP residues 5-148 10116
163 2BKH 2 B CALMODULIN 7227
164 2V02 1 A CALMODULIN 9606
165 5AFP 1 A, B NEURONAL CALCIUM SENSOR 1 10116
166 6B8M 2 B, D, F, H Calmodulin-1 9606
167 1TCO 2 B SERINE/THREONINE PHOSPHATASE B2 CHAIN A IS THE CATALYTIC SUBUNIT, RESIDUES 18 -392. CHAIN B IS THE REGULATORY SUBUNIT, RESIDUES 1 - 169 9913 3.1.3.16 | Details
168 1QIW 1 A, B CALMODULIN 9913
169 1KK8 2 B Myosin Regulatory Light Chain, Striated adductor muscle MYOSIN REGULATORY LIGHT CHAIN 31199
170 1KK8 3 C Myosin Essential Light Chain,Striated adductor muscle MYOSIN ESSENTIAL LIGHT CHAIN 31199
171 4ZLK 2 B Calmodulin 10090
172 3TUY 2 B, E Myosin regulatory light chain 6577
173 3TUY 3 C, F Myosin essential light chain 6577
174 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
175 1BJF 1 A, B NEUROCALCIN DELTA 9913
176 3EWT 1 A Calmodulin 9606
177 2VAS 2 B CALMODULIN 7227
178 1Y6W 1 A Calmodulin 9606
179 5SVE 2 B Calcineurin subunit B type 1 9606
180 1CTR 1 A CALMODULIN 9606
181 1L7Z 1 A CALMODULIN 9606
182 5G4P 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
183 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
184 4BYF 2 B, D CALMODULIN 9606
185 1QVI 2 Y Myosin regulatory light chain, striated adductor muscle 31199
186 1QVI 3 Z Myosin essential light chain, striated adductor muscle 31199
187 4MBE 1 A, D Cell division control protein 31 4932
188 3KF9 1 A, C Caltractin UNP residues 20-168 out of 168 3190
189 3DVK 1 A Calmodulin 9606
190 5G58 1 A, E Neuron-specific calcium-binding protein hippocalcin 9606
191 3BXK 1 A, C Calmodulin 10116
192 1B7T 2 Y MYOSIN REGULATORY LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
193 1B7T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN PAPAIN DIGESTED, SUBFRAGMENT 1 (S1) 31199
194 1QIV 1 A CALMODULIN 9913
195 1A29 1 A CALMODULIN 9913
196 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
197 2FOT 1 A Calmodulin 9913
198 3HR4 2 B, D, F, H Calmodulin 9606
199 4ORA 2 B Calcineurin subunit B type 1 9606
200 3OX6 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
201 4OV2 1 A, B, C, D Neuronal calcium sensor 1 C-terminal truncation (UNP residues 1-177) 10116
202 3QRX 1 A Centrin 3055
203 6B8Q 2 B, D, F, H Calmodulin-1 9606
204 3GN4 2 B, D, F, H Calmodulin 7227
205 3FWC 1 A, E, I, M Cell division control protein 31 4932
206 3JTD 2 B Myosin regulatory light chain, striated adductor muscle 31199
207 3JTD 3 C Myosin essential light chain, striated adductor muscle 31199
208 1SCM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
209 1SCM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
210 3EWV 1 A Calmodulin 9606
211 4ORC 2 B Calcineurin subunit B type 1 regulatory subunit 9606
212 2BEC 1 A Calcineurin B homologous protein 2 9606
213 3OXQ 1 A, B, C, D Calmodulin 9606
214 1K90 2 D, E, F CALMODULIN 9606
215 4GOW 1 D Calmodulin 9606
216 2F2P 1 A, B Calmodulin fused with calmodulin-binding domain of calcineurin 9913 3.1.3.16 | Details
217 4ANJ 2 B CALMODULIN 7227
218 4OVN 1 A, B, C, D, E Calmodulin 9606
219 5HIT 1 A Calmodulin 9031
220 2MYS 2 B MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
221 2MYS 3 C MYOSIN PROTEOLYTIC FRAGMENT OF MYOSIN GENERATED BY PAPAIN DIGESTION SUBFRAGMENT-1 9031
222 1V1G 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
223 3I5G 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
224 3I5G 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
225 3OX5 1 A, B, C, D, E, F Calcium-binding protein 1 UNP residues 219-370 9606
226 4E50 1 A Calmodulin, Linker, IQ motif of Neurogranin chimera of Calmodulin, Linker, IQ motif of Neurogranin 10090
227 5V7X 2 B Calmodulin-1 9606
228 5I0I 2 C Calmodulin 9606
229 5I0I 3 E Calmodulin 9606
230 4ORB 2 B Calcineurin subunit B type 1 regulatory subunit 10090
231 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
232 1SR6 2 B Myosin regulatory light chain, striated adductor muscle 31199
233 1SR6 3 C Myosin essential light chain, striated adductor muscle 31199
234 1J1D 1 A, D Troponin C 9606
235 4UMO 2 C, D CALMODULIN 9606
236 4JPZ 3 C, I Calmodulin 9606
237 1DEG 1 A CALMODULIN 9913
238 5M6C 1 A Neuron-specific calcium-binding protein hippocalcin 9606
239 5M6C 2 E Neuron-specific calcium-binding protein hippocalcin 9606
240 4YRU 1 A, B, C, D Neuronal calcium sensor 1 UNP residues 1-177 10116
241 3DVJ 1 A Calmodulin 9606
242 3DVM 1 A Calmodulin 9606
243 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
244 1M63 2 B, F CALCINEURIN B SUBUNIT ISOFORM 1 9606
245 2HET 1 A, B, C, D Recoverin 9913
246 1V1F 1 A CALCINEURIN B-LIKE PROTEIN 4 3702
247 4E53 1 A, B Calmodulin, Linker, IQ motif of Neuromodulin chimera of Calmodulin, Linker, IQ motif of Neuromodulin 10090
248 1S5G 2 Y Myosin regulatory light chain, striated adductor muscle 31199
249 1S5G 3 Z Myosin essential light chain, striated adductor muscle 31199
250 4WPX 1 A, D Cell division control protein 31-like protein 209285
251 1W7I 2 B MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM RESIDUES 59-208 9606
252 2BKI 2 B, D CALMODULIN 9031
253 3I5F 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
254 3I5F 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
255 2GV5 1 A, B, D, E Cell division control protein 31 4932
256 5D43 1 A, B Centrin-1 10090
257 1L2O 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
258 1L2O 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
259 2DOQ 1 A, B, C Cell division control protein 31 4932
260 1MF8 2 B CALCINEURIN B SUBUNIT ISOFORM 1 9606 3.1.3.16 | Details
261 1S26 2 D, E, F Calmodulin 9606
262 1SK6 2 D, E, F Calmodulin 9606
263 1K93 2 D, E, F CALMODULIN 9606
264 2I2R 2 E, F, G, H, M, N, O, P Kv channel-interacting protein 1 conserved structural core (residues 37-216) 9606
265 1BR1 2 B, D, F, H MYOSIN MG, ADP, ALF(4) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
266 1KQM 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
267 1KQM 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
268 1J1E 1 A, D Troponin C 9606
269 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
270 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
271 1KK7 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE REGULATORY LIGHT CHAIN 31199
272 1KK7 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE ESSENTIAL LIGHT CHAIN 31199
273 2NZ0 1 A, C Kv channel-interacting protein 1 N-terminal deletion domain 9606
274 2OTG 2 B Myosin regulatory light chain 6577
275 2OTG 3 C Myosin essential light chain 6577
276 1YTZ 3 C Troponin C 9031
277 3I5I 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
278 3I5I 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
279 4R8G 2 A, B, H Calmodulin 8355
280 1PK0 2 D, E, F Calmodulin 9606
281 1QX7 1 A, B, I, M, R Calmodulin 10116
282 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
283 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
284 3I5H 2 B Myosin regulatory light chain LC-2, mantle muscle 6637
285 3I5H 3 C Myosin catalytic light chain LC-1, mantle muscle 6637
286 2EC6 2 B Myosin regulatory light chain residues 23-156 6577
287 2EC6 3 C Myosin essential light chain 6577
288 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
289 1KWO 2 B MYOSIN REGULATORY LIGHT CHAIN 31199
290 1KWO 3 C MYOSIN ESSENTIAL LIGHT CHAIN 31199
291 2OS8 2 B Myosin regulatory light chain Myosin RLC 6577
292 2OS8 3 C Myosin essential light chain Myosin ELC 6577
293 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
294 4JQ0 2 C Calmodulin 9606
295 1BR4 2 B, D, F, H MYOSIN MG, ADP, BEF(3) CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT 9031 3.6.4.1 | Details
296 1LVC 2 D, E, F calmodulin 9606
297 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
298 1DFL 2 W, Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
299 1DFL 3 X, Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
300 1DFK 2 Y MYOSIN HEAD REGULATORY LIGHT CHAIN 31199
301 1DFK 3 Z MYOSIN HEAD ESSENTIAL LIGHT CHAIN 31199
302 1YV0 3 C Troponin C, skeletal muscle 9031
303 6E2F 2 E Calmodulin-1 9606
304 6E2G 2 E Calmodulin-1 9606
305 6CNM 2 E, F, G, H Calmodulin-1 9606
306 6CNN 2 E, F, G, H Calmodulin-1 9606
307 6CNO 2 E, F, G, H Calmodulin-1 9606
308 6C1D 3 R Calmodulin 32644
309 6C1G 2 R Calmodulin 32644
310 6C1H 3 R Calmodulin 32644
311 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
312 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
313 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
314 5OEO 1 A Calmodulin-1 9606
315 5VMS 2 B Calmodulin 9606
316 5H53 2 B Myosin regulatory light chain 2, skeletal muscle isoform type 1 UNP residues 25-170 9986
317 5H53 3 C Myosin light chain 1/3, skeletal muscle isoform UNP residues 41-192 9986
318 5TP5 1 A Calmodulin 9606
319 5TP6 1 A Calmodulin 9606
320 5TBY 3 E, F Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYOSIN 2 REGULATORY LIGHT CHAIN, VENTRICULAR CARDIAC MUSCLE, FREE (CHAIN E) AND BLOCKED (CHAIN F) HEAD HOMOLOGY MODEL OF HUMAN BETA CARDIAC HEAVY MEROMYOSIN INTERACTING-HEADS MOTIF 9606
321 5T7C 1 A Hippocalcin-like protein 1 Myristoyl group is covalently attached to the N-terminal 9606
322 5T0X 1 A Calmodulin 8355
323 5SY1 1 C, D Calmodulin 7108
324 5GGM 1 A Calmodulin 9606
325 5B7X 1 A Calmodulin, putative 5759
326 5K7L 2 B Calmodulin 9606
327 5J8H 1 A Calmodulin 9606
328 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
329 2N8J 1 A Calmodulin 9606
330 3JBH 2 C, D, I, J MYOSIN 2 ESSENTIAL LIGHT CHAIN STRIATED MUSCLE ESSENTIAL LIGHT CHAIN (ELC) 6896
331 2N6A 1 A human calmodulin/connexin-36 peptide hybrid 9606
332 3JAX 2 C, D smooth muscle myosin essential light chain 6183
333 2N27 1 A Calmodulin UNP residues 2-149 9606
334 2MGU 1 A Calmodulin 10116
335 2MG5 1 A Calmodulin UNP residues 2-149 9606
336 2MES 1 A Calmodulin 8355
337 3J41 2 E, F Calmodulin 9606
338 2M55 1 A Calmodulin 9606
339 2M3S 1 A Calmodulin UNP residues 1-149 9031
340 2M28 1 A Calcium-binding protein 4 10090
341 2M29 1 A Calcium-binding protein 4 10090
342 2M0J 1 A Calmodulin 9606
343 2M0K 1 A Calmodulin 9606
344 2LV6 1 A Calmodulin 9606
345 2LMT 1 A Calmodulin-related protein 97A 7227
346 2LMU 1 A Calmodulin-related protein 97A 7227
347 2LMV 1 A Calmodulin-related protein 97A 7227
348 2LL6 1 A Calmodulin 9606
349 2LL7 1 A Calmodulin 9606
350 2LHH 1 A Calmodulin UNP RESIDUES 2-121 4932
351 2LHI 1 A Calmodulin, Serine/threonine-protein phosphatase 2B catalytic subunit A1 THE FUSION PROTEIN OF CALMODULIN (RESIDUE 1-146), LINKER (GSSTG) AND CALCINEURIN A1 (RESIDUES 453-476) 32630
352 2LGF 1 A Calmodulin sequence database residues 4-149 9606
353 2LCP 1 A Neuronal calcium sensor 1 9606
354 2LC5 1 A Calmodulin, putative UNP RESIDUES 1-85 5759
355 2LAN 1 A Calcium-binding protein 1 EF-hands 1-4 9606
356 2LAP 1 A Calcium-binding protein 1 EF-hands 1-4 9606
357 3J04 2 B, E Myosin regulatory light chain 2, smooth muscle major isoform S-1 SUBFRAGMENT 9031
358 3J04 3 C, F Myosin light polypeptide 6 S-1 SUBFRAGMENT 9031
359 2L7L 1 A Calmodulin 9606
360 2L53 1 A Calmodulin calmodulin 9606
361 2L2E 1 A Calcium-binding protein NCS-1 4896
362 2L1W 1 A Calmodulin 3847
363 2KNE 1 A Calmodulin 9606
364 2KDU 1 A Calmodulin 8355
365 2W4T 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
366 2W4T 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
367 2W4U 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
368 2W4V 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
369 2W4V 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
370 2W4W 2 Y MYOSIN REGULATORY LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN REGULATORY LIGHT CHAIN, RLC, STRIATED ADDUCTOR MUSCLE RESIDUES 16-151 31199
371 2W4W 3 Z MYOSIN ESSENTIAL LIGHT CHAIN, STRIATED ADDUCTOR MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN, ELC, STRIATED ADDUCTOR MUSCLE RESIDUES 5-155 31199
372 2W4G 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
373 2W4G 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
374 2W4H 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
375 2W4H 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
376 2W49 1 0, 3, 6, 9 TROPONIN C, SKELETAL MUSCLE RESIDUES 5-163 9031
377 2W4A 1 B MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM RESIDUES, 16-165 9031
378 2W4A 2 C MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM RESIDUES, 5-149 9031
379 3DTP 3 C, D Smooth muscle myosin essential light chain 9031
380 2K61 1 A Calmodulin 9606
381 2K0J 1 A calmodulin 9606
382 2K0E 1 A Calmodulin 9606
383 2K0F 1 A calmodulin 9606
384 2JZI 1 A Calmodulin 9606
385 2JU0 1 A Calcium-binding protein NCS-1 4932
386 2JTZ 1 A Troponin C, slow skeletal and cardiac muscles 9606
387 2JT8 1 A Troponin C, slow skeletal and cardiac muscles 9606
388 2JT3 1 A Troponin C 9606
389 2JT0 1 A Troponin C, slow skeletal and cardiac muscles 9606
390 2JNF 1 A Troponin C 212017
391 2E30 1 A Calcium-binding protein p22 9606
392 2I94 1 A Recoverin 9913
393 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
394 1X02 1 A calmodulin 8355
395 1SY9 1 A CALMODULIN 8355
396 1NWD 1 A Calmodulin 8355
397 1O1E 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
398 1O1E 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
399 1O1G 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
400 1O1G 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
401 1O1A 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
402 1O1A 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
403 1O1C 2 B, E, H, K, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
404 1O1C 3 C, F, I, L, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
405 1O1D 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
406 1O1D 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
407 1O19 2 B, E, H, K, N, T SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
408 1O19 3 C, F, I, L, O, U SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
409 1O1B 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
410 1O1B 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
411 1O1F 2 B, E, H, K SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
412 1O1F 3 C, F, I, L SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
413 1O18 2 E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN 9031
414 1O18 3 F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN 9031
415 1MVW 2 B, E, H, K, N, Q SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN 9031
416 1MVW 3 C, F, I, L, O, R SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN 9031
417 1M8Q 2 B, E, H, Q Skeletal muscle Myosin II Regulatory Light Chain 9031
418 1M8Q 3 C, F, I, R Skeletal muscle Myosin II Essential Light Chain 9031
419 1LKJ 1 A Calmodulin 4932
420 1LA0 1 A Troponin C, slow skeletal and cardiac muscles 9031
421 1LA3 1 A Recoverin 9913
422 1I84 2 T, W SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN S1 FRAGMENT 9031
423 1I84 3 U, Z SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN S1 FRAGMENT 9031
424 1GGW 1 A PROTEIN (CDC4P) 4896
425 1FPW 1 A CALCIUM-BINDING PROTEIN NCS-1 4932
426 1CFF 1 A CALMODULIN 8355
427 1CKK 1 A Calmodulin-1 8355
428 1MUX 1 A CALMODULIN 8355
429 1JSA 1 A RECOVERIN 9913
430 1AJ4 1 A TROPONIN C CARDIAC TROPONIN C, CALCIUM IONS BOUND AT SITES II, III AND IV 9031
431 1DMO 1 A CALMODULIN 8355
432 1IKU 1 A RECOVERIN 9913
433 1CFD 1 A CALMODULIN 8355
434 1TNW 1 A TROPONIN C 9031
435 1TNX 1 A TROPONIN C 9031
436 1CFC 1 A CALMODULIN 8355
437 2BBM 1 A CALMODULIN 7227
438 2BBN 1 A CALMODULIN 7227