Sequence Similarity Clusters for the Entities in PDB 1G9N

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 7 10 2913
95 % 7 10 3621 Flexibility: Low
Max RMSD: 1.4, Avg RMSD: 0.9
PDBFlex
90 % 9 13 2812
70 % 86 130 184
50 % 86 130 225
40 % 86 130 242
30 % 86 133 251
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 21 38 733
95 % 25 43 881 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.2
PDBFlex
90 % 25 43 915
70 % 25 43 944
50 % 25 43 976
40 % 25 43 1006
30 % 25 43 990
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 42256
95 % 22 32 1175 Flexibility: Low
Max RMSD: 3.5, Avg RMSD: 0.8
PDBFlex
90 % 552 788 2
70 % 1711 2474 1
50 % 3468 5011 1
40 % 3468 5011 1
30 % 4108 5941 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 40970
95 % 19 25 1467 Flexibility: Low
Max RMSD: 3.9, Avg RMSD: 1.0
PDBFlex
90 % 19 25 1493
70 % 1673 2424 2
50 % 3469 5011 1
40 % 3469 5011 1
30 % 4109 5941 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4NZU 2 H 13PL light chain Fab 9606
3 1MJU 1 L IMMUNOGLOBULIN MS6-12 Fab fragment, LIGHT CHAIN 10090
4 1MJU 2 H IMMUNOGLOBULIN MS6-12 Fab fragment, HEAVY CHAIN 10090
5 4TRP 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
6 4TRP 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
7 1MEX 1 L Fab 29G12 light chain 10090
8 1MEX 2 H Fab 29G12 heavy chain 10090
9 3D9A 2 L Light Chain of HyHel10 Antibody Fragment (Fab) 10090
10 3D9A 3 H Heavy Chain of HyHel10 Antibody Fragment (Fab) 10090
11 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
12 6EH4 2 E Human T Cell Receptor Beta Chain 9606
13 4BUH 1 A, B CLONE M0418 SCFV 9606
14 3TV3 1 L PGT128 light chain, Ig lambda-2 chain C regions PGT128 light chain 9606
15 3TV3 2 H PGT128 heavy chain, Ig gamma-1 chain C region PGT128 heavy chain 9606
16 6FR4 1 A TCR 003 alpha chain 9606
17 6FR4 2 B TCR 003 Beta Chain 9606
18 1NCW 1 L IMMUNOGLOBULIN IGG2A Antibody FAB fragment 4C6, light chain 10090
19 1NCW 2 H IMMUNOGLOBULIN IGG2A Antibody FAB fragment 4C6, heavy chain 10090
20 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
21 6EH5 2 B Human T Cell Receptor Beta Chain 9606
22 5UD9 1 H Fab heavy chain 9606
23 5UD9 2 L Light chain 9606
24 4P48 1 A Antibody scFv 180 9031
25 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
26 4UDT 2 B PROTEIN TRBV7-9, T-CELL RECEPTOR BETA-2 CHAIN C REGION VARIABLE DOMAIN TRBV7-9, RESIDUES 20-115, CONSTANT DOMAIN TRBC2, RESIDUES 1-129 9606
27 5TY6 1 H VRC 315 13-1b02 Fab Heavy chain 9606
28 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
29 6FR3 1 A 003 TCR Alpha Chain 9606
30 6FR3 2 B 003 TCR Beta Chain 9606
31 2XZC 1 H FAB A.17 HEAVY CHAIN 9606
32 2XZC 2 L FAB A.17 LIGHT CHAIN 9606
33 2XKN 1 A, C ANTI-EGFR ANTIBODY 7A7 FAB FRAGMENT LIGHT CHAIN (IGG1), RESIDUES 1-223 10090
34 2XKN 2 B, D ANTI-EGFR ANTIBODY 7A7 FAB FRAGMENT HEAVY CHAIN (IGG1), RESIDUES 1-216 10090
35 5KVG 2 L ZV-67 Antibody Fab Light Chain 10090
36 5KVG 3 H ZV-67 Antibody Fab Heavy Chain 10090
37 5WCA 1 H VRC315 27-1C08 Fab Heavy chain 9606
38 5WCA 2 L VRC315 27-1C08 Fab Light chain 9606
39 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
40 6FR5 2 B TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, beta chain 9606
41 4XCF 1 L 4E10 Fab light chain 9606
42 4XCF 2 H 4E10 Fab heavy chain 9606
43 5KVF 2 L ZV-64 Antibody Fab Light Chain 10090
44 5KVF 3 H ZV-64 Antibody Fab Heavy Chain 10090
45 1RUP 1 L immunoglobulin igg2a, heavy chain fab 10090
46 1RUP 2 H immunoglobulin igg2a, light chain fab 10090
47 3ESU 1 F Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker 10090
48 1RUK 1 L immunoglobulin igg2a, light chain fab 10090
49 1RUK 2 H immunoglobulin igg2a, heavy chain fab 10090
50 5VXR 1 H MAb24 Variable Heavy Chain,MAb24 Variable Heavy Chain 10090
51 5VXR 2 L MAb24 Variable Light Chain,MAb24 Variable Light Chain 10090
52 5X08 1 H Fab 4E10 Heavy chain 9606
53 5X08 2 L Fab 4E10 Light chain 9606
54 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
55 4WW1 2 B TCR Beta Chain-TRBV7-8 9606
56 4XAW 1 L 4E10 Fab light chain 9606
57 4XAW 2 H 4E10 Fab heavy chain 9606
58 4P49 1 A Antibody scFv B8 9031
59 3N9G 1 H Fab fragment of MAb CR4354, heavy chain 9606
60 3N9G 2 L Fab fragment of MAb CR4354, light chain 9606
61 4TUL 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
62 4TUL 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
63 2NW2 1 A ELS4 TCR alpha chain 9606
64 2NW2 2 B ELS4 TCR beta chain 9606
65 5UCB 1 H Fab Heavy Chain 9606
66 5UCB 2 L Fab Light Chain 9606
67 2VXV 1 H HUMAN IGG ABT-325 9606
68 2VXV 2 L HUMAN IGG ABT-325 9606
69 4GXV 1 H, I Antibody 1F1, heavy chain 9606
70 4GXV 2 L, M Antibody 1F1, light chain 9606
71 6AT6 1 B T-cell receptor beta variable 28, Human nkt tcr beta chain chimera 9606
72 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
73 2VXT 1 H MURINE IGG 125-2H 10090
74 2VXT 3 L MURINE IGG 125-2H 10090
75 1RUM 1 L immunoglobulin igg2a, light chain fab 10090
76 1RUM 2 H immunoglobulin igg2a, heavy chain fab 10090
77 2XZA 1 H FAB A.17 HEAVY CHAIN 9606
78 2XZA 2 L FAB A.17 LIGHT CHAIN 9606
79 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
80 1OGA 5 E T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR, RESIDUES 1-130 9606
81 2W60 1 A ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 10090
82 2W60 2 B ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 10090
83 5W24 1 L 5C4 Fab Light Chain 10090
84 5W24 2 H 5C4 Fab Heavy Chain 10090
85 4HPY 1 H CH59 Fab heavy chain 9606
86 4HPY 2 L CH59 Fab light chain 9606
87 3T65 1 B S25-2 FAB (IGG1K) heavy chain 10090
88 3T65 2 A S25-2 FAB (IGG1K) light chain 10090
89 5C6W 1 H, J Protein IGHV1-69-2,Ig lambda chain V-II region NIG-84 9606
90 4JG1 1 L Fab light chain 9606
91 4JG1 2 H Fab heavy chain 9606
92 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
93 3M8O 2 H IMMUNOGLOBULIN A1 HEAVY CHAIN Fab fragment 9606
94 5VF2 1 A scFv 2D10 10090
95 5I8C 1 A VRC34.01 Fab heavy chain 9606
96 5I8C 2 B VRC34.01 Fab light chain 9606
97 4O5L 1 L Fab F045-092 light chain 9606
98 4O5L 2 H Fab F045-092 heavy chain 9606
99 5MYX 1 A, C Fab c#24 light chain 10090
100 5MYX 2 B, D Fab c#24 heavy chain Pyroglutamate residue 1 (PCA) results from post-translational modification of original residue glutamine 1. 10090
101 3IFL 1 L 12A11 FAB antibody light chain 10090
102 3IFL 2 H 12A11 FAB antibody heavy chain 10090
103 5WK2 1 L M116 LIGHT CHAIN 9606
104 5WK2 2 H M116 HEAVY CHAIN FD 9606
105 3PP4 1 H GA101 Fab heavy chain 10090
106 3PP4 2 L GA101 Fab light chain 10090
107 3KDM 1 A, L Immunoglobulin light chain 9606
108 3KDM 2 B, H Immunoglobulin heavy chain 9606
109 5NIV 1 A Light chain of 5D3 Fab 10090
110 5NIV 2 B Heavy chain of 5D3 Fab 10090
111 5N4J 1 L LIGHT CHAIN 9606
112 5N4J 2 H HEAVY CHAIN the sequence provided include the cleavable tag 9606
113 2AJU 1 L ANTIBODY 7A1 FAB' IMMUNOGLOBULIN IGG1 KAPPA LIGHT CHAIN 10090
114 2AJU 2 H ANTIBODY 7A1 FAB' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
115 2AJV 1 L Antibody 7A1 Fab' IMMUNOGLOBULIN IGG1 KAPPA LIGHT CHAIN 10090
116 2AJV 2 H Antibody 7A1 Fab' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
117 5X4G 1 A 6H8 Fab heavy chain 10090
118 5X4G 2 B 6H8 Fab light chain 10090
119 3SY0 1 A S25-2 FAB (IGG1K) light chain 10090
120 3SY0 2 B S25-2 FAB (IGG1K) heavy chain 10090
121 4PTU 1 A Antibody pn132p2C05, light chain 9606
122 4PTU 2 B Antibody pn132p2C05, heavy chain 9606
123 4TPR 1 L If kappa light chain 10090
124 4TPR 2 H Fab heavy chain 10090
125 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
126 4HS6 3 B, H MRCT10.v362 Fab heavy chain 9606
127 3IFN 1 H 12A11 FAB antibody heavy chain 10090
128 3IFN 2 L 12A11 FAB antibody light chain 10090
129 5U3P 1 H DH511.4 Fab Heavy Chain 9606
130 5U3P 2 L DH511.4 Fab Light Chain 9606
131 4TOY 1 H 35O22 Fab Heavy chain 9606
132 4TOY 2 L 35O22 Fab Light chain 9606
133 4TUO 1 A, C Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
134 4TUO 2 B, D Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
135 3NPS 2 B S4 FAB HEAVY CHAIN 9606
136 3NPS 3 C S4 FAB LIGHT CHAIN 9606
137 5I4F 1 A scFv 2D10 10090
138 1RUR 1 L immunoglobulin 13G5, light chain fab 10090
139 1RUR 2 H immunoglobulin 13G5, heavy chain fab 10090
140 5VAA 1 A, B Ig gamma-2A chain C region, A allele UNP residues 107-330 10090
141 5ADO 1 H FAB A.17 HEAVY CHAIN 9606
142 5ADO 2 L FAB A.17 LIGHT CHAIN 9606
143 5WN9 1 H scFv 2D10 9606
144 4XC3 1 L 4E10 Fab light chain 9606
145 4XC3 2 H 4E10 Fab heavy chain 9606
146 1X9Q 1 A 4m5.3 anti-fluorescein single chain antibody fragment antibody binding fragment 9606
147 4M5Y 1 H, I Fab 5J8 heavy chain 9606
148 4M5Y 2 L, M Fab 5J8 light chain 9606
149 4TQE 1 L If kappa light chain 10090
150 4TQE 2 H Fab heavy chain 10090
151 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
152 2BNU 2 B T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-130 9606
153 4ISV 1 A 1C2 FAB LIGHT CHAIN 10090
154 4ISV 2 B 1C2 FAB HEAVY CHAIN 10090
155 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
156 4XC1 2 H 4E10 FAB HEAVY CHAIN 9606
157 5VSI 1 H CH1/Ckappa Fab heavy chain 9606
158 5VSI 2 L CH1/Ckappa Fab light chain 9606
159 4CMH 2 B HEAVY CHAIN OF SAR650984-FAB FRAGMENT 10090
160 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
161 5JXA 1 H VRC03 Heavy chain 9606
162 5JXA 2 L VRC03 Light chain 9606
163 3QHZ 1 H, I Human monoclonal antibody del2D1, Fab Heavy Chain Fab Heavy Chain 9606
164 3QHZ 2 L, M Human monoclonal antibody del2D1, Fab Light Chain Fab Light Chain 9606
165 3UJI 1 L Light chain of anti-HIV-1 V3 monoclonal antibody 2558 9606
166 3UJI 2 H Fab region of the heavy chain of anti-HIV-1 V3 monoclonal antibody 2558 9606
167 3NTC 1 L Fab light chain 10090
168 3NTC 2 H Fab heavy chain 10090
169 4YNY 1 A, C Heavy chain of antigen binding fragment, Fab 10116
170 4YNY 2 B, D Light chain of antigen binding fragment, Fab 10116
171 4TUK 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
172 4TUK 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
173 4YO0 1 A, C Heavy chain of antigen binding fragment, Fab 10116
174 4YO0 2 B, D Light chain of antigen binding fragment, Fab 10116
175 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
176 6AZM 2 B, D 580 germline antibody, heavy chain Fragment: Fab 9606
177 6BE3 1 H Fab (F598) Heavy Chain 9606
178 6BE3 2 L Fab (F598) Light Chain 9606
179 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
180 6FUN 2 B Human F11 T-Cell Receptor beta chain 9606
181 4NWU 1 H APE1551 Ab Fab heavy chain 9606
182 4NWU 2 L APE1551 Ab Fab light chain 9606
183 1KGC 1 D T-cell receptor alpha chain 9606
184 1KGC 2 E T-cell receptor beta chain 9606
185 3HC4 1 H IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
186 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
187 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
188 6FRC 2 B Human T-Cell Receptor beta Chain 9606
189 5VZR 1 A, H G4 antibody heavy chain Fab fragment 10090
190 5VZR 2 B, L G4 antibody light chain Fab fragment 10090
191 2W9D 1 H ICSM 18-ANTI-PRP THERAPEUTIC FAB HEAVY CHAIN 10090
192 2W9D 2 L ICSM 18-ANTI-PRP THERAPEUTIC FAB LIGHT CHAIN 10090
193 5EWI 1 H VRC38.01 Heavy Chain 9606
194 5EWI 2 L VRC38.01 Light Chain 9606
195 5E2W 1 L AT8 LIGHT CHAIN 10090
196 5E2W 2 H AT8 HEAVY CHAIN 10090
197 5MYK 1 A Fab c#17 light chain 10090
198 5MYK 2 B Fab c#17 heavy chain 10090
199 6FUQ 1 A Human F11 T-Cell Receptor 9606
200 6FUQ 2 B Human F11 T-Cell Receptor beta chain 9606
201 4NZR 1 H PGT135 heavy chain Fab 9606
202 4NZR 2 L PGT135 light chain Fab 9606
203 5MYO 1 A, C Fab c#6 light chain 10090
204 5MYO 2 B, D Fab c#6 heavy chain 10090
205 4HBC 1 H Antigen Binding Fragment, Immunoglobulin IgG - Heavy Chain 9986
206 4HBC 2 L Antigen Binding Fragment, Immunoglobulin IgG - Light Chain 9986
207 4AEH 1 H FAB ANTIBODY, HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-231 10090
208 4AEH 2 L FAB ANTIBODY, LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-214 10090
209 5UEL 1 H 354NC102 Fab Heavy Chain 9606
210 5UEL 2 L 354NC102 Fab Light Chain 9606
211 3UZQ 1 A anti-dengue Mab 4E11 Single chain variable fragment 10090
212 2V17 2 H MONOCLONAL ANTIBODY FAB FRAGMENT MN423 DISULPHIDE BRIDGE BETWEEN L214 AND H137 IS REDUCED 10090
213 2V17 3 L MONOCLONAL ANTIBODY FAB FRAGMENT MN423 DISULPHIDE BRIDGE BETWEEN L214 AND H137 IS REDUCED 10090
214 4J6R 2 H HEAVY CHAIN OF ANTIBODY VRC23 9606
215 4J6R 3 L LIGHT CHAIN OF ANTIBODY VRC23 9606
216 5E2V 1 L AT8 LIGHT CHAIN 10090
217 5E2V 2 H AT8 HEAVY CHAIN 10090
218 5SY8 1 H 10E8 FAB HEAVY CHAIN 9606
219 5SY8 2 L 10E8 FAB LIGHT CHAIN 9606
220 5DD1 1 H ANTI-HIV ANTIBODY DH570 FAB HEAVY CHAIN 9544
221 5DD1 2 L ANTI-HIV ANTIBODY DH570 FAB LIGHT CHAIN 9544
222 5JUE 1 L light chain of UIC2 Fab 10090
223 5JUE 2 H heavy chain of UIC2 Fab 10090
224 5CIN 1 H FAB 4E10 HEAVY CHAIN 9606
225 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
226 5A2J 1 H SCFV-SM3 CONTAINS BOTH H AND L CHAINS OF SCFV-SM3, CONNECTEDBY A LINKER. CHAIN L RESIDUES ARE NUMBERED FROM 1000. RESIDUES 6-115,20-129 10090
227 5JR1 1 H 10E8 heavy chain 9606
228 5JR1 2 L 10E8 mature light chain 9606
229 5VF6 1 A single chain variable fragment 9031
230 3CFB 1 A, L BLUE FLUORESCENT ANTIBODY EP2-19G2-KAPPA LIGHT CHAIN FAB 10090
231 3CFB 2 B, H BLUE FLUORESCENT ANTIBODY EP2-19G2-IGG2B HEAVY CHAIN FAB 10090
232 3WII 1 L, M anti-human ROBO1 antibody B2212A Fab light chain 10090
233 3WII 2 H, I anti-human ROBO1 antibody B2212A Fab heavy chain 10090
234 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
235 6FR9 2 B T-Cell Receptor F11 beta chain 9606
236 5OB5 2 H fAb Heavy chain 9606
237 5OB5 3 L fAb Light chain 9606
238 3BKJ 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
239 3BKJ 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
240 5I66 1 A 8B6 antibody, heavy chain 10090
241 5I66 2 B 8B6 antibody, light chain 10090
242 4JAM 1 A, H ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103 9606
243 4JAM 2 B, L ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103 9606
244 3QQ9 1 C, L 101F LIGHT CHAIN 10090
245 3QQ9 2 D, H 101F HEAVY CHAIN 10090
246 5TKK 2 H mouse antibody vFP5.01 heavy chain 10090
247 5TKK 3 L mouse antibody vFP5.01 light chain 10090
248 5FGB 1 A, B Anti-HCV E2 Fab HC84-1 light chain 9606
249 5FGB 2 C, E Anti-HCV E2 Fab HC84-1 heavy chain 9606
250 5W6C 1 H UCA Fab heavy chain 9606
251 5W6C 2 L UCA Fab light chain 9606
252 5I1K 1 L FAB LIGHT CHAIN 9606
253 5I1K 2 H FAB HEAVY CHAIN 9606
254 3OZ9 1 L Fab NC-1 kappa light chain 10090
255 3OZ9 2 H Fab NC-1 IgG2a heavy chain 10090
256 4JDV 1 A, H Fab heavy chain NIH45-46 Germ-line HEAVY CHAIN, IG GAMMA-1 CHAIN 9606
257 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
258 5V7U 1 L CBTAU-22.1 Fab light chain 9606
259 5V7U 2 H CBTAU-22.1 Fab heavy chain 9606
260 5UEA 1 A, H Fab Heavy Chain 9606
261 5UEA 3 B, L Fab Light Chain 9606
262 4AL8 2 H FAB 2H12 HEAVY CHAIN 9606
263 4AL8 3 L FAB 2H12 LIGHT CHAIN 9606
264 3G5Y 1 A 175 light chain 10090
265 3G5Y 2 B 175 heavy chain 10090
266 5NMV 1 L Fab light chain 10088
267 5NMV 2 H Fab heavy chain 10088
268 4N8C 1 H, I Heavy chain of monoclonal antibody 10090
269 4N8C 2 L, M Light chain of monoclonal antibody 10090
270 5AZ2 1 H anti-human epiregulin antibody 9E5 Fab heavy chain 10090
271 5AZ2 2 L anti-human epiregulin antibody 9E5 Fab light chain 10090
272 4HGW 1 A Antibody Fab fragment, light chain 10090
273 4HGW 2 B Antibody Fab fragment, heavy chain 10090
274 1NLB 1 L antibody 19D9D6 light chain 10090
275 1NLB 2 H antibody 19D9D6 heavy chain 10090
276 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
277 1C5C 2 H CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 109-230) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-108) IS FROM MURINE SOURCE FAB 10090
278 3VFG 1 L 3F8 Light Chain 10090
279 3VFG 2 H 3F8 Heavy Chain 10090
280 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
281 5TDN 2 B, D anti-HER2 Fab Heavy Chain 9606
282 3QRG 1 L Fab light chain 9606
283 3QRG 2 H Fab heavy chain Fd fragment 9606
284 5M6A 1 A, B, C, D Bence-Jones light chain 9606
285 4LLY 2 B, D light chain Clambda 9606
286 4EBQ 1 H anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, heavy chain Fab 10090
287 4EBQ 2 L anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, light chain 10090
288 5EZI 1 H Fab c12 heavy chain 9606
289 5EZI 2 L Fab c12 Light chain 9606
290 5U66 2 A IgG1 fc derived from CD4-fc fusion 9606
291 4K23 1 H anti-uPAR antibody, heavy chain 10090
292 4K23 2 L anti-uPAR antibody, light chain 10090
293 3NCJ 1 L Fab15 Mut8 light chain 9606
294 3NCJ 2 H Fab15 Mut8 heavy chain 9606
295 3UO1 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
296 3UO1 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
297 4M1G 1 L Murine IgG2a A27D7 Light chain Fab domain 10090
298 4M1G 2 H Murine IgG2a A27D7 Heavy chain Fab domain 10090
299 5W05 1 L M59 FAB LIGHT CHAIN 10090
300 5W05 2 H M59 FAB HEAVY CHAIN FD 10090
301 2IPU 1 K, L IgG2a Fab fragment Heavy Chain 10090
302 2IPU 2 G, H IgG2a Fab fragment Light Chain Kappa 10090
303 3HC3 1 H IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
304 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
305 4M61 1 A, C Fab A52 light chain 10090
306 4M61 2 B, D Fab A52 heavy chain 10090
307 3BKM 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
308 3BKM 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
309 1UM5 1 L Antibody 21H3 L chain 10090
310 1UM5 2 H Antibody 21H3 H chain 10090
311 3QHF 1 H Human monoclonal antibody del2D1, Fab Heavy Chain Fab Heavy Chain 9606
312 3QHF 2 L Human monoclonal antibody del2D1, Fab Light Chain Fab Light Chain 9606
313 4NWT 1 L APE1531 Ab Fab light chain 9606
314 4NWT 2 H APE1531 Ab Fab heavy chain 9606
315 3WHX 1 A mAb Fab H fragment 10090
316 3WHX 2 B mAb Fab L fragment 10090
317 3NA9 1 L Fab15 light chain 9606
318 3NA9 2 H Fab15 heavy chain 9606
319 3BAE 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
320 3BAE 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
321 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
322 6FUO 2 B Human F11 T-Cell Receptor 9606
323 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
324 1NGZ 2 B Germline Metal Chelatase Catalytic Antibody, Heavy chain germline Fab fragment 10090
325 4LRI 1 A, B MSL-109 Light Chain 9606
326 4LRI 2 C, P MSL-109 Heavy Chain 9606
327 4ZTP 1 L Light chain of Fab fragment of rabbit monoclonal antibody R53 9986
328 4ZTP 2 H Heavy chain of Fab fragment of rabbit monoclonal antibody R53 9986
329 4JN2 1 A, L anti dabigatran Fab 10090
330 4JN2 2 B, H anti dabigatran Fab 10090
331 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
332 4XBE 2 H 4E10 Fab heavy chain 9606
333 1MJ8 1 L IMMUNOGLOBULIN MS6-126 Fab Fragment, LIGHT CHAIN 10090
334 1MJ8 2 H IMMUNOGLOBULIN MS6-126 Fab Fragment, HEAVY CHAIN 10090
335 6BE2 1 H Fab (F598) Heavy Chain 9606
336 6BE2 2 L Fab (F598) Light Chain 9606
337 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
338 4EI6 2 B, D Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
339 4JFZ 1 L Fab light chain 9606
340 4JFZ 2 H Fab heavy chain 9606
341 3WIF 1 A mAb Fab H fragment 10090
342 3WIF 2 B mAb Fab L fragment 10090
343 5U6A 1 A Light Chain 9606
344 5U6A 2 B Heavy Chain 9606
345 5KVD 2 L ZV-2 Antibody Fab Light Chain 10090
346 5KVD 3 H ZV-2 Antibody Fab Heavy Chain 10090
347 3MBX 1 L X836 LIGHT CHAIN 10090
348 3MBX 2 H X836 HEAVY CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN, FD fragment 10090
349 3TWC 1 L PGT127 light chain, Ig lambda-2 chain C regions 9606
350 3TWC 2 H PGT127 heavy chain, Ig gamma-1 chain C region 9606
351 6APC 1 H Epididymis luminal protein 214 9606
352 6APC 2 L IGL@ protein 9606
353 4HHA 1 A Fab KE5 Fab fragment KE5 9606
354 4HHA 2 B Antibody KE5 AD-2S1 eptiope 9606
355 5A2K 1 H IG LAMBDA-1 CHAIN V REGION S43 RESIDUES 6-115,20-129 10090
356 4RGO 2 H 14G8 heavy chain Fab 10090
357 4RGO 3 L 14G8 light chain Fab 10090
358 5GRY 1 A, G diabody 9606
359 5UEK 2 H Fab 12E Heavy Chain 9606
360 5UEK 3 L Fab 12E Light Chain 9606
361 3NAA 1 L Fab15 Mut5 light chain 9606
362 3NAA 2 H Fab15 Mut5 heavy chain 9606
363 1Q0X 1 L Fab 9B1, light chain 10090
364 1Q0X 2 H Fab 9B1, heavy chain 10090
365 4R90 1 L Anti CD70 Llama glama Fab 27B3 Light chain 9844
366 4R90 2 H Anti CD70 Llama glama Fab 27B3 Heavy chain 9844
367 4XVT 2 H donor 45 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Heavy chain 9606
368 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
369 5IK3 1 A, C 1E03 Fab fragment heavy chain 9606
370 5IK3 2 B, D 1E03 Fab fragment light chain 9606
371 5NPH 2 H Heavy chain of Fab fragment derived from non-neutralizing antibody DAO5 10090
372 5NPH 3 L Light chain of Fab fragment derived from non-neutralizing antibody DAO5 10090
373 5IHZ 1 A, C, E, H 1E01 Fab fragment heavy chain 9606
374 5IHZ 2 B, D, F, L 1E01 Fab fragment light chain 9606
375 2R1X 1 A Fab, antibody fragment (IgG1k), light chain 10090
376 2R1X 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
377 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
378 5U3D 2 B MEMAB TRASTUZUMAB FAB HEAVY CHAIN 9606
379 4WUK 1 H CH65 heavy chain 9606
380 4WUK 2 L CH65 light chain 9606
381 3MLY 1 L, M Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain 9606
382 3MLY 2 H, I Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain 9606
383 5U3O 1 H DH511.2_K3 Fab Heavy Chain 9606
384 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
385 5JOP 1 D, L Fab 14.22 light chain 10090
386 5JOP 2 E, H Fab14.22 heavy chain 10090
387 4HPO 1 H CH58 Fab heavy chain 9606
388 4HPO 2 L CH58 Fab light chain 9606
389 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
390 6FUP 2 B Huamn F11 T-Cell Receptor beta chain 9606
391 5UKN 1 H DH522UCA Fab fragment heavy chain 9544
392 5UKN 2 L DH522UCA Fab fragment light chain 9544
393 6BHZ 1 H, I Trastuzumab Anti-HER2 Fab Heavy Chain 9606
394 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
395 5IT2 1 H heavy chain 9606
396 5IT2 2 L light chain 9606
397 5JIH 1 A, B Ig gamma-1 chain C region Hinge-CH2-CH3, UNP Residues 108-329 9606
398 4POZ 1 C light chain of Fab fragment of 10B9 antibody 10090
399 4POZ 2 D heavy chain of Fab fragment of 10B9 antibody 10090
400 4F57 1 L Light chain of Fab of a neutralizing antibody L1 light chain of L1 9606
401 4F57 2 H Heavy chain of Fab of a neutralizing antibody L1 heavy chain of L1 9606
402 2W59 1 A, B IGY FCU3-4 9031
403 1L6X 1 A IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION Fc Fragment, Residues 119-325 9606
404 5GZ0 1 A, C FM329 light chain 1383439
405 5GZ0 2 B, D FM329 heavy chain 1383439
406 6BQB 1 L MGG4 Fab light chain 9606
407 6BQB 2 H MGG4 Fab heavy chain 9606
408 4PUB 1 H DX-2930 HEAVY CHAIN 9606
409 4PUB 2 L DX-2930 LIGHT CHAIN 9606
410 6B14 1 H Heavy chain of Fab BL3-6S97N 10090
411 6B14 2 L Light chain of Fab BL3-6S97N 10090
412 5DD6 1 A, H ANTI-HIV ANTIBODY DH570.mut58 FAB HEAVY CHAIN 9544
413 5DD6 2 B, L ANTI-HIV ANTIBODY DH570.mut58 FAB LIGHT CHAIN 9544
414 5TEZ 4 I TCR F50 alpha chain 9606
415 5TEZ 5 J TCR F50 beta chain 9606
416 3WIH 2 L, M anti-human ROBO1 antibody B2212A Fab light chain 10090
417 3WIH 3 H, I anti-human ROBO1 antibody B2212A Fab heavy chain 10090
418 5GS3 1 A, H diabody protein 9606
419 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
420 4DZB 2 B Vbeta2 (MAIT T cell receptor) 9606
421 3CFC 1 H BLUE FLUORESCENT ANTIBODY EP2-19G2-IGG2B HEAVY CHAIN FAB 10090
422 3CFC 2 L BLUE FLUORESCENT ANTIBODY EP2-19G2-KAPPA LIGHT CHAIN FAB 10090
423 3V4U 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
424 3V4U 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
425 2R1Y 1 A Fab, antibody fragment (IgG1k), light chain 10090
426 2R1Y 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
427 5XHG 1 A, C polypeptide(L) 562
428 5XHG 2 B, D polypeptide(H) 562
429 4XMP 2 H HEAVY CHAIN OF ANTIBODY VRC08 9606
430 4XMP 3 L LIGHT CHAIN OF ANTIBODY VRC08 9606
431 3UYR 1 H antibody Fab heavy chain 10090
432 3UYR 2 L antibody Fab light chain 10090
433 3V0W 1 L WN1 222-5 Fab (IgG2a) light chain 10090
434 3V0W 2 H WN1 222-5 Fab (IgG2a) heavy chain 10090
435 1YQV 1 L HyHEL-5 Antibody Light Chain IG*G1 FAB FRAGMENT (HY/HEL-5) 10090
436 1YQV 2 H HyHEL-5 Antibody Heavy Chain IG*G1 FAB FRAGMENT (HY/HEL-5) 10090
437 3OAZ 1 H, M Fab 2G12, heavy chain Fab 9606
438 3OAZ 2 K, L Fab 2G12, light chain 9606
439 2R2B 1 A Fab, antibody fragment (IgG1k), light chain 10090
440 2R2B 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
441 1ZAN 1 L Fab AD11 Light Chain 10116
442 1ZAN 2 H Fab AD11 Heavy Chain 10116
443 4BSV 1 A HETERODIMERIC FC ANTIBODY AZYMETRIC VARIANT 2 IG GAMMA 1 FC DOMAIN, RESIDUES 106-330 9606
444 4BSV 2 B HETERODIMERIC FC ANTIBODY AZYMETRIC VARIANT 2 IG GAMMA 1 FC DOMAIN, RESIDUES 106-330 9606
445 4N0Y 1 H IGH526 Heavy Chain 9606
446 4N0Y 2 L IGH526 Light Chain 9606
447 3V52 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
448 3V52 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
449 3GGW 1 A, C FAB F22-4 LIGHT CHAIN 10090
450 3GGW 2 B, D FAB F22-4 HEAVY CHAIN 10090
451 1BEC 1 A 14.3.D T CELL ANTIGEN RECEPTOR 10090
452 1RZF 1 L Fab E51 light chain 9606
453 1RZF 2 H Fab E51 heavy chain 9606
454 4KTE 1 H GE148 Heavy Chain Fab Fab fragment 9544
455 4KTE 2 L GE148 Light Chain Fab 9544
456 5I8O 1 H HMM5 antibody heavy chain 9606
457 5I8O 2 L HMM5 antibody light chain 9606
458 4OUO 1 A anti Bla g 1 scFv 9031
459 4JG0 1 L Fab light chain 9606
460 4JG0 2 H Fab heavy chain 9606
461 4YGV 1 A, F aDabi-Fab2a heavy chain 9606
462 4YGV 2 B, L aDabi-Fab2a light chain 9606
463 5U4R 1 A, H VRC 315 53-1A09 Fab Heavy chain 9606
464 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
465 5ALC 1 H ANTI-TICAGRELOR FAB 72, HEAVY CHAIN 9606
466 5ALC 2 L ANTI-TICAGRELOR FAB 72, LIGHT CHAIN 9606
467 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
468 5U5F 2 B MEMAB TRASTUZUMAB FAB HEAVY CHAIN 9606
469 3EO0 1 A, C GC-1008 Fab Light Chain 10090
470 3EO0 2 B, D GC-1008 Fab Heavy Chain 10090
471 5CIL 1 H FAB 4E10 HEAVY CHAIN 9606
472 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
473 6BI2 1 H, I Trastuzumab Anti-HER2 Fab Heavy Chain 9606
474 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
475 5F3B 1 A, E RK35 Chimeric antibody heavy chain 10090
476 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
477 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
478 6FUR 2 B, D Human F11 T-Cell Receptor 9606
479 4FQI 3 H antibody CR9114 heavy chain Fab 9606
480 4FQI 4 L antibody CR9114 light chain Fab Lambda 9606
481 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
482 6FUM 2 B Human F11 T-Cell Receptor beta chain 9606
483 4JHA 1 H D25 antigen-binding fragment heavy chain 9606
484 4JHA 2 L D25 light chain 9606
485 3MCL 1 L C706 MONOCLONAL LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
486 3MCL 2 H C706 MONOCLONAL HEAVY CHAIN FD fragment of the heavy chain, CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
487 4PTT 1 A Antibody pn132p2C05, light chain 9606
488 4PTT 2 B Antibody pn132p2C05, heavy chain 9606
489 5KVL 1 H Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) heavy chain Fab fragment 9606
490 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
491 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
492 5TDO 2 B, D anti-HER2 Fab Heavy Chain 9606
493 8FAB 1 A, C IGG1-LAMBDA HIL FAB (LIGHT CHAIN) 9606
494 8FAB 2 B, D IGG1-LAMBDA HIL FAB (HEAVY CHAIN) 9606
495 5NHW 1 H anti-human ActRII Bimagrumab Fab heavy-chain C-terminal FLAG-His6 tag Fab heavy-chain 9606
496 5NHW 2 L anti-human ActRII Bimagrumab Fab light-chain Fab light-chain 9606
497 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
498 5M02 4 H T-cell receptor beta chain V region C5,T-cell receptor beta-2 chain C region 10090
499 2ZPK 1 L, M IgG1-lambda P20.1 Fab (light chain) 10090
500 2ZPK 2 H, I IgG1-lambda P20.1 Fab (heavy chain) Variable and Constant region 10090
501 4DGV 1 H HCV1 Heavy Chain Fab 9606
502 4DGV 2 L HCV1 Light Chain 9606
503 2DQU 1 L IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
504 2DQU 2 H IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
505 5TH2 1 A, C cetuximab Fab, light chain 10090
506 5TH2 2 B, D cetuximab Fab, heavy chain 10090
507 4W4O 1 A, B Ig gamma-1 chain C region UNP residues 107-330 9606
508 5I8K 1 L HHH1 Fab Light chain 9606
509 5I8K 2 H HHH1 Fab Heavy chain 9606
510 4YDL 2 B, H HEAVY CHAIN OF ANTIBODY C38-VRC18.02 9606
511 4YDL 3 C, L LIGHT CHAIN OF ANTIBODY C38-VRC18.02 9606
512 3T4Y 1 A S25-2 FAB (IGG1K) LIGHT CHAIN 10090
513 3T4Y 2 B S25-2 FAB (IGG1K) HEAVY CHAIN 10090
514 1YNL 1 L Ig gamma light chain 10090
515 1YNL 2 H Ig gamma heavy chain 10090
516 5EPM 1 A, E Antibody Fab fragment heavy chain 10090
517 5EPM 2 B, F Antibody Fab fragment light chain 10090
518 2AJS 1 L Antibody 7A1 FAB' IMMUNOGLOBULIN IGG1 kappa light chain 10090
519 2AJS 2 H Antibody 7A1 FAB' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
520 5VH5 1 A Infliximab Fc 10090
521 3UMT 1 A scFv heavy chain and light chain 10090
522 3BZ4 1 A, C, E, G Fab F22-4 light chain 10090
523 3BZ4 2 B, D, F, H Fab F22-4 heavy chain 10090
524 4NUJ 1 A PGT152 light chain 9606
525 4NUJ 2 B PGT152 heavy chain 9606
526 3LIZ 2 L 4C3 monoclonal antibody Light Chain 10090
527 3LIZ 3 H 4C3 monoclonal antibody Heavy Chain 10090
528 1RUA 1 L immunoglobulin igg2a, light chain fab 10090
529 1RUA 2 H immunoglobulin igg2a, heavy chain fab 10090
530 3U2S 1 A, H PG9 heavy chain antigen-binding fragment 9606
531 3U2S 2 B, L PG9 light chain 9606
532 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
533 5D6C 2 B, H 4497 antibody IgG1 (VH and CH1) 9606
534 4GAG 1 H NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN 10090
535 4GAG 2 L NEUTRALIZING ANTIBODY AP33 LIGHT CHAIN 10090
536 2R23 1 A Fab, antibody fragment (IgG1k), light chain 10090
537 2R23 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
538 5JII 1 A, B Ig gamma-1 chain C region Hinge-CH2-CH3, UNP Residues 108-329 9606
539 4NUG 1 L PGT151 light chain 9606
540 4NUG 2 H PGT151 heavy chain 9606
541 3IU4 1 H chP3 Fab heavy chain 10090
542 3IU4 2 L chP3 Fab light chain 10090
543 3MNZ 2 A ANTI-HIV-1 ANTIBODY 13H11 LIGHT CHAIN mouse Fv,human Fc 10090
544 3MNZ 3 B ANTI-HIV-1 ANTIBODY 13H11 HEAVY CHAIN mouse Fv,human Fc 10090
545 3MLR 1 L Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain 9606
546 3MLR 2 H Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain 9606
547 1QYG 1 L FAB M82G2, LIGHT CHAIN 10090
548 1QYG 2 H FAB M82G2, HEAVY CHAIN 10090
549 1P7K 1 A, L antibody light chain FAB 10090
550 1P7K 2 B, H antibody heavy chain FAB 10090
551 3RVV 2 C 4C1 - light chain 10090
552 3RVV 3 D 4C1 - heavy chain 10090
553 5A2L 1 H SCFV-SM3 RESIDUES 6-115,20-129 10090
554 3P0Y 2 H Fab DL11 heavy chain 9606
555 3P0Y 3 L Fab DL11 light chain 9606
556 4NPY 1 A, L germline PGT121 light chain Fab 9606
557 4NPY 2 B, H germline PGT121 heavy chain Fab 9606
558 6ANA 2 H LL2 Fab Heavy Chain 10090
559 6ANA 3 L LL2 Fab Light Chain 10090
560 5IBU 1 B, L 6652 Light Chain 9606
561 5IBU 2 G, H 6652 Heavy Chain 9606
562 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
563 6FRA 2 B Human T-Cell Receptor F11 beta Chain 9606
564 5VPL 2 C 4C1 - LIGHT CHAIN 10090
565 5VPL 3 D 4C1 - HEAVY CHAIN 10090
566 6AOD 1 A FXIa Antibody FAB Light Chain 9606
567 6AOD 2 B FXIa Antibody FAB Heavy Chain 9606
568 5WCD 1 H VRC315 04-1D02 Fab Heavy chain 9606
569 5WCD 2 L VRC315 04-1D02 Fab Light chain 9606
570 2YPV 2 H FAB 12C1 10090
571 2YPV 3 L FAB 12C1 10090
572 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
573 4HH9 2 B, D Fab KE5, heavy chain KE5 Heavy Chain 9606
574 4JY5 1 L PGT122 light chain Fab 9606
575 4JY5 2 H PGT122 heavy chain Fab 9606
576 6ELE 1 A, H fAB heavy chain 9606
577 6ELE 2 B, L fAB light chain 9606
578 5UR8 1 A human immunoglobulin gamma, heavy chain Fd fragment 9606
579 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
580 6B5R 1 H CIS42 Fab Heavy chain 9606
581 6B5R 2 L CIS42 Fab Light chain 9606
582 5W38 1 A, B Immunoglobulin heavy constant gamma 3 Fc domain, UNP residues 155-377 9606
583 3NAC 1 L Fab15 Mut7 light chain 9606
584 3NAC 2 H Fab15 Mut7 heavy chain 9606
585 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
586 5U5M 2 B MEMAB TRASTUZUMAB, HEAVY CHAIN 9606
587 2DQT 1 L IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
588 2DQT 2 H IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
589 1Q72 1 L Fab M82G2, Light chain 10090
590 1Q72 2 H Fab M82G2, Heavy chain 10090
591 4M1D 1 L, M Fab mAb 447-52D Light Chain 9606
592 4M1D 2 H, I Fab mAb 447-52D Heavy Chain 9606
593 1SEQ 1 L Monoclonal Antibody MNAC13 FAB Light Chain 10090
594 1SEQ 2 H Monoclonal Antibody MNAC13 FAB Heavy Chain 10090
595 4YHO 1 H aDabi-Fab3 heavy chain 9606
596 4YHO 2 L aDabi-Fab3 light chain 9606
597 2R1W 1 A Fab, antibody fragment (IgG1k), light chain 10090
598 2R1W 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
599 3MO1 1 A ANTI-HIV-1 ANTIBODY 13H11 LIGHT CHAIN FUSION PROTEIN between mouse Fv and a human Fc 10090
600 3MO1 2 B ANTI-HIV-1 ANTIBODY 13H11 HEAVY CHAIN FUSION PROTEIN between mouse Fv and a human Fc 10090
601 4DGY 1 H HCV1 Heavy Chain Fab 9606
602 4DGY 2 L HCV1 Light Chain 9606
603 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
604 6EH6 2 B Human T Cell Receptor BetaChain 9606
605 5EN2 1 A GD01 heavy chain 10090
606 5EN2 2 B GD01 light chain 10090
607 3T77 1 A S25-2 FAB (IGG1K) light chain 10090
608 3T77 2 B S25-2 FAB (IGG1K) heavy chain 10090
609 3MXW 2 L 5E1 light chain 9606
610 3MXW 3 H 5E1 heavy chain 9606
611 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
612 2V7N 2 B, D, F, H IMMUNOGLOBULIN HEAVY CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-259 32630
613 3EO9 1 L Efalizumab Fab fragment, light chain 9606
614 3EO9 2 H Efalizumab Fab fragment, heavy chain 9606
615 4ALA 2 H FAB 2H12 HEAVY CHAIN 10090
616 4ALA 3 L FAB 2H12 LIGHT CHAIN 10090
617 4F33 1 A, C, E, G MORAb-009 FAB light chain 10090
618 4F33 2 B, D, F, H MORAb-009 FAB heavy chain 10090
619 3C6S 1 A, C, E, G Fab F22-4 light chain 10090
620 3C6S 2 B, D, F, H Fab F22-4 heavy chain 10090
621 5WUV 1 L light chain 9606
622 5WUV 2 H heavy chain 9606
623 4Z8F 1 H S1-15 Fab (IgG2b) heavy chain 10090
624 4Z8F 2 L S1-15 Fab (IgG2b kappa) light chain 10090
625 3OKL 1 A S25-39 Fab (IgG1k) light chain 10090
626 3OKL 2 B S25-39 Fab (IgG1k) heavy chain 10090
627 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
628 2BNQ 5 E T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR, RESIDUES 1-130 9606
629 4JM4 1 H PGT 135 Heavy Chain Fab 9606
630 4JM4 2 L PGT 135 Light Chain Fab 9606
631 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
632 2HWZ 2 H Immunoglobulin Fab heavy chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
633 6B0G 1 C 1245 Antibody, Light Chain 9606
634 6B0G 2 D 1245 Antibody, Heavy Chain 9606
635 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
636 5TDP 2 B, D anti-HER2 Fab Heavy Chain 9606
637 1ZEA 1 L monoclonal anti-cholera toxin IGG1 KAPPA antibody, L chain 10090
638 1ZEA 2 H monoclonal anti-cholera toxin IGG1 KAPPA antibody, H chain 10090
639 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
640 4WNQ 2 B, D TCR Variable Beta 2 (TRBV20) chain and TCR constant Beta chain 9606
641 2Q86 2 B, D Vbeta8.2 extracellular domain 10090
642 6BE4 1 H Fab (F598) Heavy Chain 9606
643 6BE4 2 L Fab(F598) Light Chain 9606
644 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
645 6FRB 2 B Human T-Cell Receptor F11 beta Chain 9606
646 5TPP 1 L DH270.5 Fab heavy chain 9606
647 5TPP 2 H DH270.5 Fab light chain 9606
648 5L88 1 H Anti-afamin antibody N14, Fab fragment, heavy chain 10090
649 5L88 2 L Anti-afamin antibody N14, Fab fragment, light chain 10090
650 1Q9W 1 A, C S45-18 Fab (IgG1k) light chain Fab1 Light chain kappa 10090
651 1Q9W 2 B, D S45-18 Fab (IgG1k) heavy chain Fab1 Heavy chain g1 10090
652 4P3C 1 H Heavy Chain Fab fragment of antibody LEM-2/15 MT1-MMP V-B loop 10090
653 4P3C 2 L Light Chain Fab fragment of antibody LEM-2/15 10090
654 5D7K 1 D MAV36 TCR Alpha Chain 9606
655 5D7K 2 E MAV36 TCR Beta Chain 9606
656 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
657 1L7I 2 H chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence heavy chain (residues 1-216) 9606
658 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
659 1JPT 2 H immunoglobulin Fab D3H44, heavy chain Fab fragment 9606
660 1AQK 1 L FAB B7-15A2 IMMUNOGLOBULIN HUMAN FAB FAB 9606
661 1AQK 2 H FAB B7-15A2 IMMUNOGLOBULIN HUMAN FAB FAB 9606
662 5TL5 1 L M2177 LIGHT CHAIN 10090
663 5TL5 2 H M2177 HEAVY CHAIN 10090
664 2FX7 1 L Fab 4E10 Light Chain 9606
665 2FX7 2 H Fab 4E10 Heavy Chain 9606
666 5W5N 1 A, B Immunoglobulin heavy constant gamma 4 Sigma2 Fc fragment, UNP residues 106-327 9606
667 5Y9K 1 L belimumab light chain 9606
668 5Y9K 2 H belimumab heavy chain 9606
669 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
670 4DTG 2 H Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, heavy chain 9606
671 5CSZ 1 A, H GANTENERUMAB FAB FRAGMENT HEAVY CHAIN FAB 9606
672 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
673 3WFH 1 A mAb Fab H fragment 10090
674 3WFH 2 B mAb Fab L fragment 10090
675 4K3D 1 H, I BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN 9913
676 4K3D 2 L, M BOVINE ANTIBODY WITH ULTRALONG CDR H3, LIGHT CHAIN 9913
677 4H8W 2 H FAB HEAVY CHAIN OF ADCC AND NON-NEUTRALIZING ANTI-HIV-1 ANTIBODY N5-I5 9606
678 4H8W 3 L FAB LIGHT CHAIN OF ADCC AND NON-NEUTRALIZING ANTI-HIV-1 ANTIBODY N5-I5 9606
679 3HNT 1 H CS-35 Fab Heavy Chain Heavy Chain 10090
680 3HNT 2 L CS-35 Fab Light Chain Light Chain 10090
681 5HYF 1 A Ig gamma-1 chain C region Knob protein UNP residues 104-330 9606
682 1WEJ 1 L E8 ANTIBODY IGG1 KAPPA MOUSE MONOCLONAL ANTIBODY FAB 10090
683 1WEJ 2 H E8 ANTIBODY IGG1 KAPPA MOUSE MONOCLONAL ANTIBODY FAB 10090
684 5VPG 2 C FAB 4C1 - LIGHT CHAIN 10090
685 5VPG 3 D FAB 4C1 - HEAVY CHAIN 10090
686 5HI4 2 C, H CAT-2000 FAB heavy chain 9606
687 5HI4 3 D, L CAT-2000 FAB light chain 9606
688 5NUZ 1 A, H eOD01 heavy chain Fab fragment (domains: variable heavy and constant heavy 1) Fab fragment (domains: variable heavy and constant heavy 1) 10090
689 5NUZ 2 B, L eOD01 light chain Fab fragment (domains: variable light and constant light) Fab fragment (domains: variable light and constant light) 10090
690 5FCU 2 H JR4 FAB HEAVY CHAIN 9544
691 5FCU 3 L JR4 FAB LIGHT CHAIN 9544
692 3RVW 2 C 4C1 - light chain 10090
693 3RVW 3 D 4C1 - heavy chain 10090
694 5DD3 1 H ANTI-HIV ANTIBODY DH570.4 FAB HEAVY CHAIN 9544
695 5DD3 2 L ANTI-HIV ANTIBODY DH570.4 FAB LIGHT CHAIN 9544
696 4C54 1 A, B IG GAMMA-4 CHAIN C REGION FC FRAGMENT, RESIDUES 114-327 9606
697 5XKU 2 B HNIgGA6 light chain 9606
698 5XKU 3 C HNIgGA6 heavy chain 9606
699 4W4N 1 A, B Ig gamma-1 chain C region UNP residues 107-329 9606
700 3D85 1 A FAB of antibody 7G10, light chain light chain 9606
701 3D85 2 B FAB of antibody 7G10, heavy chain heavy chain 9606
702 4Z95 1 H S1-15 Fab (IgG2b) heavy chain 10090
703 4Z95 2 L S1-15 Fab (IgG2b) light chain 10090
704 5HI5 2 C, H CAT-2000 FAB heavy chain 9606
705 5HI5 3 D, L CAT-2000 light chain 9606
706 5JO5 1 A, C, E, H 10E8 gHV 9606
707 5JO5 2 B, D, F, L 10E8 gLV 9606
708 5L9D 1 H MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN 10090
709 5L9D 2 L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN 10090
710 5CCK 1 H Antibody 3BC315 Fab heavy chain 9606
711 5CCK 2 L Antibody 3BC315 Fab light chain 9606
712 3VXS 3 D H27-14 TCR alpha chain 9606
713 3VXS 4 E H27-14 TCR beta chain 9606
714 5I76 1 A, C FM318_light_chain 1383439
715 5I76 2 B, D FM318_heavy_cahin 1383439
716 1KCV 1 L PC282 IMMUNOGLOBULIN light chain 10090
717 1KCV 2 H PC282 IMMUNOGLOBULIN heavy chain 10090
718 1FLR 1 L 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT 10090
719 1FLR 2 H 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT 10090
720 5I18 1 L FAB LIGHT CHAIN 9606
721 5I18 2 H FAB HEAVY CHAIN 9606
722 4JN1 1 H anti-dabigatran Fab1, heavy chain 10090
723 4JN1 2 L anti-dabigatran Fab1, light chain 10090
724 4P3D 1 A, H Heavy Chain Fab fragment of antibody LEM-2/15 10090
725 4P3D 2 B, L Light Chain Fab fragment of antibody LEM-2/15 10090
726 4G5Z 1 H canakinumab antibody fragment heavy chain 9606
727 4G5Z 2 L canakinumab antibody fragment light chain 9606
728 3TNM 1 A, H Fab heavy chain of human anti-HIV-1 Env antibody A32 9606
729 3TNM 2 B, L Fab light chain of human anti-HIV-1 Env antibody A32 9606
730 2OK0 2 L Fab ED10 light chain 10090
731 2OK0 3 H Fab ED10 heavy chain 10090
732 3SOB 1 L antibody light chain 9606
733 3SOB 3 H antibody heavy chain 9606
734 6B5M 1 H CIS43 Fab Heavy chain 9606
735 6B5M 2 L CIS43 Fab Light chain 9606
736 5AWN 1 H Heavy chain of 3BC176 Fab 9606
737 5AWN 2 L Light chain of 3BC176 Fab 9606
738 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
739 4ZFO 3 A, H J22.9-xi Fab, Heavy Chain Fab Heavy Chain fragment of anti-BCMA antibody J22.9-xi 10090
740 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
741 4G6M 2 H heavy chain of gevokizumab antibody binding fragment 10090
742 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
743 5DR5 1 H AbD09097 Fab heavy chain The Fab heavy chain contains a C-terminal Myc- and hexahistidine extension preceded by thrombin peptidase recognition sequence to facilitate detection and purification 9606
744 5DR5 2 L AbD09097 Fab light chain 9606
745 2IH3 1 A FAB Heavy Chain 10090
746 2IH3 2 B FAB Light Chain 10090
747 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
748 2P5E 5 E Hypothetical protein 9606
749 4KQ3 1 L CNTO3186 light chain Fab 9606
750 4KQ3 2 H CNTO3186 heavy chain Fab 9606
751 6AQ7 2 H POM6 FAB Heavy CHAIN 10090
752 6AQ7 3 L POM6 FAB light CHAIN 10090
753 4JFX 1 A, L Fab light chain 9606
754 4JFX 2 B, H Fab heavy chain 9606
755 3SGE 1 I, L Light Chain 10090
756 3SGE 2 H, J Heavy Chain 10090
757 1BM3 1 L IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN CONSTANT DOMAIN 10090
758 1BM3 2 H IMMUNOGLOBULIN OPG2 FAB, VARIABLE DOMAIN VARIABLE DOMAIN 10090
759 4TUJ 1 A, C Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
760 4TUJ 2 B, D Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
761 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
762 4L4V 4 E, H MAIT T-cell receptor beta chain 9606
763 2VXQ 2 H FAB H CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
764 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
765 2XWT 1 A THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 HEAVY CHAIN FAB FRAGMENT HEAVY CHAIN, RESIDUES 1-229 9606
766 2XWT 2 B THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 LIGHT CHAIN FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-213 9606
767 5FHB 1 H Antibody 100 Fab heavy chain 9606
768 5FHB 2 L Antibody 100 Fab light chain 9606
769 3HZM 1 A S73-2 Fab (IgG1k) light chain 10090
770 3HZM 2 B S73-2 Fab (IgG1k) heavy chain 10090
771 1JGU 1 L Antibody Light Chain 10090
772 1JGU 2 H Antibody Heavy Chain 10090
773 4I77 1 H Lebrikizumab heavy chain Fab 9606
774 4I77 2 L Lebrikizumab light chain Fab 9606
775 4OCR 1 L CAP256-VRC26.01 light chain Fab 9606
776 4OCR 2 H CAP256-VRC26.01 heavy chain Fab 9606
777 4O4Y 1 L 2095-2 light chain SEE REMARK 999 9986
778 4O4Y 2 H 2095-2 heavy chain 9986
779 3Q5Y 1 A, B, C, D TCR N15 beta 10090
780 5OBF 1 H fAb Heavy chain 10090
781 5OBF 2 L fAb Light chain 10090
782 5LGH 1 H MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN IGG1-KAPPA HEAVY CHAIN, 1-214 10090
783 5LGH 2 L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN IGG1-KAPPA LIGHT CHAIN, 1-214 10090
784 1UZ8 1 A, L IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-212 10090
785 1UZ8 2 B, H IGG FAB (IGG3, KAPPA) HEAVY CHAIN 291-2G3-A FAB FRAGMENT HEAVY CHAIN, RESIDUES 1-213 10090
786 1DQQ 1 A, C ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN) FAB FRAGMENT 10090
787 1DQQ 2 B, D ANTI-LYSOZYME ANTIBODY HYHEL-63 (HEAVY CHAIN) FAB FRAGMENT 10090
788 5L7X 1 H Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain IgG1-kappa heavy chain, 1-214 10090
789 5L7X 2 L Mouse Antibody Fab Fragment, IgG1-kappa Light Chain IgG1-kappa light chain, 1-214 10090
790 5V6M 1 L Light chain of Fab fragment of rabbit anti-HIV1 gp120 V3 mAb 10A3 9986
791 5V6M 2 H Heavy chain of Fab fragment of rabbit anti-HIV1 gp120 V3 mAb 10A3 9986
792 4GLR 2 H, J anti-ptau heavy chain heavy chain 9031
793 4GLR 3 I, K anti-ptau light chain light chain 9031
794 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
795 5WK3 2 Q, S, U, W M116 HEAVY CHAIN FD 9606
796 2VUO 1 A, B IG GAMMA CHAIN C REGION FC FRAGMENT, RESIDUES 229-447 9986
797 4HJG 1 A Trastuzumab light chain 9606
798 4HJG 2 B Trastuzumab heavy chain 9606
799 5OWP 1 H Ig heavy chain V-III region J606,Ig lambda-1 chain V region H2020 10090
800 4M43 1 L Fragment antigen-binding 523-11 light chain 10090
801 4M43 2 H Fragment antigen-binding 523-11 heavy chain 10090
802 5I30 1 L Fab PL-2 light chain 10090
803 5I30 2 H Fab PL-2 heavy chain 10090
804 3HC0 1 A, H IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
805 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
806 3BKC 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
807 3BKC 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
808 3FN0 1 L Fab Z13e1 light chain 9606
809 3FN0 2 H Fab Z13e1 heavy chain 9606
810 5X5X 1 H Fd chain of anti-osteocalcin antibody KTM219 10090
811 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
812 4YHI 1 A, H aDabi-Fab2a heavy chain 9606
813 4YHI 2 B, L aDabi-Fab2a light chain 9606
814 4OSU 1 H SM5-1 Fab Heavy Chain 9606
815 4OSU 2 L SM5-1 Fab Light Chain 9606
816 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
817 3MXV 2 H fab fragment of anti-Shh 5E1 mouse/human chimera, heavy chain 10090
818 5IFA 1 H VRC01c-HuGL2 Fab heavy chain 9606
819 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
820 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
821 5U6Q 3 E, G MAIT T-cell receptor beta chain 9606
822 1T2Q 1 L Fab NNA7 Heavy Chain 10090
823 1T2Q 2 H Fab NNA7 Light Chain 10090
824 6ELJ 1 A, H fAB heavy chain 9606
825 6ELJ 2 B, L fAB light chain 9606
826 5W5M 1 A, B Immunoglobulin heavy constant gamma 4 Sigma1 Fc fragment, UNP residues 106-327 9606
827 4G6K 1 H heavy chain of gevokizumab antibody binding fragment 10090
828 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
829 4MAU 1 L C2244 light chain SEE REMARK 999 10090
830 4MAU 2 H C2244 heavy chain FD, SEE REMARK 999 10090
831 3LEX 1 A, H 11f10 Antibody Heavy Chain 10090
832 3LEX 2 B, L 11f10 Antibody Light Chain 10090
833 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
834 6EH7 2 B Human T Cell Receptor Beta Chain 9606
835 6B0W 1 L 1710 antibody, light chain 9606
836 6B0W 2 H 1710 antibody, heavy chain 9606
837 1OP3 1 K, L FAB 2G12, light chain light chain 9606
838 1OP3 2 H, M FAB 2G12, heavy chain heavy chain 9606
839 5VH4 1 A, H Infliximab Fab Heavy Chain 10090
840 5VH4 2 B, L Infliximab Fab Light Chain 10090
841 5DQD 1 L S55-5 Fab (IgG1 kappa) light chain 10090
842 5DQD 2 H S55-5 Fab (IgG1) heavy chain 10090
843 4PJE 3 E, G TCR-alpha 9606
844 4PJE 4 F, H TCR-beta 9606
845 5DT1 1 H Fab Heavy chain of broadly neutralizing antibody VRC26.25 9606
846 5DT1 2 L Fab Light chain of broadly neutralizing antibody VRC26.25 9606
847 4ONF 1 H 3D6 FAB ANTIBODY HEAVY CHAIN 10090
848 4ONF 2 L 3D6 FAB ANTIBODY LIGHT CHAIN 10090
849 1OPG 1 L OPG2 FAB (LIGHT CHAIN) 9606
850 1OPG 2 H OPG2 FAB (HEAVY CHAIN) 9606
851 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
852 1JPS 2 H immunoglobulin Fab D3H44, heavy chain Fab fragment 9606
853 5NPJ 1 A, B Single chain variable fragment of the non-neutralizing antibody DAO5 10090
854 1NBY 1 A antibody kappa light chain first chain of Anti-Lysozyme Antibody HyHEL-63 light chain 10090
855 1NBY 2 B immunoglobulin gamma 1 chain second chain of Anti-Lysozyme Antibody HyHEL-63 10090
856 3V6O 2 C, D Monoclonal antibody 9F8 fab fragment Heavy chain Fab fragment of monoclonal antibody H chain 10090
857 3V6O 3 E, F Monoclonal antibody 9F8 fab fragment Light chain Fab fragment of monoclonal antibody L chain 10090
858 3S96 1 A, C 3B5H10 FAB heavy chain 10090
859 3S96 2 B, D 3B5H10 FAB light chain 10090
860 4LKX 1 A Fab fragment heavy chain 9606
861 4LKX 2 B Fab fragment light chain 9606
862 1Q9O 1 B, D S45-2 Fab (IgG1k) heavy chain Fab1 Heavy chain g1 10090
863 1Q9O 2 A, C S45-2 Fab (IgG1k) light chain Fab1 Light chain kappa 10090
864 3SE8 2 H Heavy chain of antibody VRC03 Antigen binding fragement of antibody heavy chain 9606
865 3SE8 3 L Light chain of antibody VRC03 antibody light chain 9606
866 5JW5 1 A, H MEDI8852 Heavy chain 9606
867 5JW5 2 B, L MEDI8852 Light chain 9606
868 5VH3 1 A, H Infliximab Fab Heavy Chain 10090
869 5VH3 2 B, L Infliximab Fab Light Chain 10090
870 5HDQ 2 H Fab Heavy Chain 10090
871 5HDQ 3 L Fab Light Chain 10090
872 4FQ2 1 H Fab heavy chain 9606
873 4FQ2 2 L Fab light chain 9606
874 3RKD 2 C, L Monoclonal Antibody, Light Chain 10090
875 3RKD 3 D, H Monoclonal Antibody, Heavy Chain 10090
876 4MS8 1 C 42F3 alpha 10090
877 4MS8 2 D 42F3 beta 10090
878 3L1O 1 H MONOCLONAL ANTIBODY FAB FRAGMENT MN423 H CHAIN 10090
879 3L1O 2 L MONOCLONAL ANTIBODY FAB FRAGMENT MN423 L CHAIN 10090
880 2A77 1 L Immunoglobulin Light Chain 10090
881 2A77 2 H Immunoglobulin Heavy Chain 10090
882 2FB4 1 L IGG1-LAMBDA KOL FAB (LIGHT CHAIN) 9606
883 2FB4 2 H IGG1-LAMBDA KOL FAB (HEAVY CHAIN) 9606
884 3GO1 1 L Fab 268-D, light chain 9606
885 3GO1 2 H Fab 268-D, heavy chain 9606
886 1F3D 1 J, L CATALYTIC ANTIBODY 4B2 LIGHT CHAIN - FAB FRAGMENT 10090
887 1F3D 2 H, K CATALYTIC ANTIBODY 4B2 HEAVY CHAIN - FAB FRAGMENT 10090
888 4G9F 4 D beta chain C12C TCR 9606
889 4G9F 5 E beta chain C12C TCR 9606
890 3QWO 1 B, L motavizumab light chain 10090
891 3QWO 2 A, H motavizumab heavy chain 10090
892 3CVI 1 H 25-D1.16 Heavy chain 10090
893 3CVI 2 L 25-D1.16 Light chain 10090
894 1PZ5 1 A Light chain of Fab (SYA/J6) 10090
895 1PZ5 2 B Heavy chain of Fab (SYA/J6) 10090
896 1LK3 2 L, M 9D7 Light Chain Fab fragment, Residues 1-210 10116
897 1LK3 3 H, I 9D7 Heavy Chain Fab fragment, Residues 1-219 10116
898 4IOI 1 A Trastuzumab light chain 9606
899 4IOI 2 B Trastuzumab heavy chain 9606
900 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
901 1N7M 2 L Germline Metal Chelatase Catalytic Antibody, chain L 10090
902 4OKV 1 A, C heavy chain of 8H7 mAb 10090
903 4OKV 2 B, D light chain of 8H7 mAb 10090
904 6B5S 1 H CIS42 Fab Heavy chain 9606
905 6B5S 2 L CIS42 Fab Light chain 9606
906 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
907 5K8A 2 B, F, H, V Heavy chain 10090
908 1JGV 1 L Antibody Light Chain 10090
909 1JGV 2 H Antibody Heavy Chain 10090
910 5VAG 2 B Light chain of antibody m826 9606
911 5VAG 3 C Heavy chain of antibody m826 9606
912 3MLX 1 L, M Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain 9606
913 3MLX 2 H, I Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain 9606
914 3I9G 1 H Sonepcizumab antibody Fab fragment, heavy chain Fab Fragment 10090
915 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
916 5GIR 1 A, H Heavy chain of Fab fragment 10090
917 5GIR 2 B, L Light chain of Fab fragment 10090
918 2ADF 2 H 82D6A3 IgG FAB 10090
919 2ADF 3 L 82D6A3 IgG FAB 10090
920 5I16 1 A, L FAB LIGHT CHAIN 9606
921 5I16 2 B, H FAB HEAVY CHAIN 9606
922 3O41 1 B, L Mouse monoclonal antibody 101F Fab light chain 10090
923 3O41 2 A, H Mouse monoclonal antibody 101F Fab heavy chain 10090
924 1SVZ 1 A, B single-chain Fv fragment 1696 scFv1696 10090
925 5F9O 2 H CH235.9 Heavy chain 9606