Sequence Similarity Clusters for the Entities in PDB 1G9N

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 9 2810
95 % 6 9 3526
90 % 8 12 2690
70 % 83 126 179
50 % 83 126 216
40 % 83 126 238
30 % 83 129 240
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 21 35 744
95 % 25 40 896
90 % 25 40 927
70 % 25 40 953
50 % 25 40 987
40 % 25 40 1005
30 % 25 40 980
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 38715
95 % 19 24 1472
90 % 450 644 3
70 % 1251 1773 2
50 % 3056 4363 1
40 % 3056 4363 1
30 % 3577 5147 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 37541
95 % 19 24 1470
90 % 19 24 1493
70 % 1476 2109 1
50 % 3057 4363 1
40 % 3057 4363 1
30 % 3578 5147 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4XCF 1 L 4E10 Fab light chain 9606
3 5X08 2 L Fab 4E10 Light chain 9606
4 4XAW 1 L 4E10 Fab light chain 9606
5 2VXV 2 L HUMAN IGG ABT-325 9606
6 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
7 5I8C 2 B VRC34.01 Fab light chain 9606
8 3PP4 2 L GA101 Fab light chain 10090
9 4PTU 1 A Antibody pn132p2C05, light chain 9606
10 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
11 4XC3 1 L 4E10 Fab light chain 9606
12 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
13 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
14 4NWU 2 L APE1551 Ab Fab light chain 9606
15 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
16 5EWI 2 L VRC38.01 Light Chain 9606
17 5E2W 1 L AT8 LIGHT CHAIN 10090
18 5E2V 1 L AT8 LIGHT CHAIN 10090
19 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
20 3QQ9 1 C, L 101F LIGHT CHAIN 10090
21 5I1K 1 L FAB LIGHT CHAIN 9606
22 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
23 5V7U 1 L CBTAU-22.1 Fab light chain 9606
24 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
25 3QRG 1 L Fab light chain 9606
26 3NCJ 1 L Fab15 Mut8 light chain 9606
27 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
28 4NWT 1 L APE1531 Ab Fab light chain 9606
29 3NA9 1 L Fab15 light chain 9606
30 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
31 4LRI 1 A, B MSL-109 Light Chain 9606
32 4JN2 1 A, L anti dabigatran Fab 10090
33 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
34 4HHA 1 A Fab KE5 Fab fragment KE5 9606
35 3NAA 1 L Fab15 Mut5 light chain 9606
36 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
37 5IK3 2 B, D 1E03 Fab fragment light chain 9606
38 5IT2 2 L light chain 9606
39 4PUB 2 L DX-2930 LIGHT CHAIN 9606
40 3OAZ 2 K, L Fab 2G12, light chain 9606
41 4YGV 2 B, L aDabi-Fab2a light chain 9606
42 3EO0 1 A, C GC-1008 Fab Light Chain 10090
43 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
44 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
45 4JHA 2 L D25 light chain 9606
46 4PTT 1 A Antibody pn132p2C05, light chain 9606
47 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
48 4DGV 2 L HCV1 Light Chain 9606
49 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
50 3IU4 2 L chP3 Fab light chain 10090
51 3P0Y 3 L Fab DL11 light chain 9606
52 5IBU 1 B, L 6652 Light Chain 9606
53 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
54 3NAC 1 L Fab15 Mut7 light chain 9606
55 4YHO 2 L aDabi-Fab3 light chain 9606
56 4DGY 2 L HCV1 Light Chain 9606
57 3MXW 2 L 5E1 light chain 9606
58 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
59 3EO9 1 L Efalizumab Fab fragment, light chain 9606
60 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
61 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
62 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
63 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
64 2FX7 1 L Fab 4E10 Light Chain 9606
65 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
66 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
67 5I18 1 L FAB LIGHT CHAIN 9606
68 4JN1 2 L anti-dabigatran Fab1, light chain 10090
69 3SOB 1 L antibody light chain 9606
70 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
71 5DR5 2 L AbD09097 Fab light chain 9606
72 4KQ3 1 L CNTO3186 light chain Fab 9606
73 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
74 4I77 2 L Lebrikizumab light chain Fab 9606
75 4HJG 1 A Trastuzumab light chain 9606
76 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
77 3FN0 1 L Fab Z13e1 light chain 9606
78 4YHI 2 B, L aDabi-Fab2a light chain 9606
79 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
80 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
81 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
82 4MAU 1 L C2244 light chain SEE REMARK 999 10090
83 1OP3 1 K, L FAB 2G12, light chain light chain 9606
84 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
85 4LKX 2 B Fab fragment light chain 9606
86 5JW5 2 B, L MEDI8852 Light chain 9606
87 3QWO 1 B, L motavizumab light chain 10090
88 4IOI 1 A Trastuzumab light chain 9606
89 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
90 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
91 5I16 1 A, L FAB LIGHT CHAIN 9606
92 5F9O 3 L CH235.09 Light chain 9606
93 4RBP 1 K, L Fab 2G12 light chain 9606
94 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
95 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
96 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
97 5GGQ 1 L nivolumab light chain 9606
98 3OAY 1 K, L Fab 2G12, light chain 9606
99 5K9J 2 L 56.a.09 light chain 9606
100 5TF1 2 L O2-CC Fab Light Chain 9606
101 3TCL 2 B, L CH04 Light Chain Fab 9606
102 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
103 5F7E 2 L Fab light chain 9606
104 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
105 5FHA 2 L Antibody 114 Fab light chain 9606
106 4X7S 2 L Ig kappa chain C region residues 23-236 9606
107 4X0K 2 B, L Fab fragment light chain 9606
108 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
109 5E8E 1 A IGA FAB LIGHT CHAIN 9606
110 2HFF 1 A, L CB2 Fab, light chain 9606
111 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
112 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
113 5GGS 2 B, D light chain 9606
114 5I1L 1 A, L FAB LIGHT CHAIN 9606
115 5GGV 1 L light chain 9606
116 3L5X 1 L H2L6 LIGHT CHAIN 9606
117 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
118 2R8S 2 L Fab light chain 10090
119 4HKZ 1 A Trastuzumab light chain 9606
120 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
121 3SO3 2 B A11 FAB light chain 9606
122 3IDG 1 A 2F5 Fab light chain 9606
123 3OAU 2 L Fab 2G12, light chain 9606
124 4WY7 2 L Fab 4E10Light chain 9606
125 4ZYK 2 B, L AM14 light chain 9606
126 5E94 1 A, C Antibody Fab fragment light chain 10090
127 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
128 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
129 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
130 4HIE 1 A Fab 023.102 9606
131 4LEX 1 L FAB HEAVY CHAIN 10090
132 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
133 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
134 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
135 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
136 4KMT 1 L light chain O12/KAPPA Fab 9606
137 3NZH 1 L 5F6 LIGHT CHAIN 10090
138 1RHH 1 A, C Fab X5, light chain 9606
139 1TJG 1 L FAB 2F5 Light Chain 9606
140 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
141 4XTR 3 D, F Antibody Light chain 32630
142 1RZ7 1 L Fab 48d light chain 9606
143 1RZG 2 B, D Fab 412d heavy chain 9606
144 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
145 3PGF 3 L SAB Light Chain 9606
146 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
147 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
148 4YHL 2 L aDabi-Fab2b light chain 9606
149 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
150 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
151 2QQN 3 L Antibody light chain 9606
152 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
153 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
154 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
155 4YHM 2 L aDabi-Fab2b light chain 9606
156 3X3F 2 L Light chain of KMTR2 9606
157 2CMR 3 L D5 9606
158 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
159 5CZX 3 D, L 20358 Fab light chain 9606
160 3GRW 2 L Fab light chain 9606
161 5I1D 1 A, L FAB LIGHT CHAIN 9606
162 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
163 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
164 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
165 5DRX 2 B, L CLL240 BCR light chain 9606
166 4HIX 2 L Humanized 3D6 Fab light chain 10090
167 4LKC 1 A Fab fragment of PCSK9 antibody 9606
168 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
169 4KZD 2 L BL3-6 Fab antibody, light chain 10090
170 4HCR 2 L, N PF-547659 light chain 9606
171 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
172 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
173 4HIH 1 A, C Fab 023.102 9606
174 4YHK 2 L aDabi-Fab2a light chain 9606
175 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
176 3DRQ 1 A 2F5 Fab' light chain 9606
177 5IES 2 L VRC01cHuGL2 Fab light chain 9606
178 4UV7 3 L GC1118A 9606
179 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
180 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
181 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
182 3D0V 1 A 2F5 Fab heavy chain 9606
183 3S34 1 L 1121B Fab light chain 10090
184 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
185 5E2T 1 L AT8 LIGHT CHAIN 10090
186 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
187 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
188 2AJ3 1 A, C, E Fab m18, Light Chain 9606
189 3IDI 1 A 2F5 Fab light chain 9606
190 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
191 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
192 4NRX 3 B, E, L m66 Light Chain 9606
193 3O2D 1 L ibalizumab light chain 10090
194 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
195 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
196 5V7R 1 L CBTAU-7.1 Fab light chain 9606
197 2R0L 1 L antibody light chain 32630
198 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
199 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
200 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
201 3Q1S 1 L Z13e1 Fab light chain 9606
202 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
203 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
204 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
205 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
206 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
207 3KR3 3 L antibody-Fab (light chain) 9606
208 5DK3 1 A, F Light Chain 9606
209 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
210 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
211 4YHN 2 B, L aDabi-Fab3 light chain 9606
212 5GGU 2 B, L light chain 9606
213 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
214 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
215 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
216 4D9Q 2 D, L Anti-Factor D, light chain 9606
217 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
218 5KW9 3 L IgA Light chain 9606
219 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
220 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
221 5DRW 2 B CLL183 BCR antibody light chain 9606
222 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
223 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
224 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
225 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
226 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
227 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
228 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
229 2FX9 1 L, M Fab 4E10 Light Chain 9606
230 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
231 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
232 1TZG 1 L, M Fab 4E10 light chain 9606
233 3W9D 2 B, D Antibody Fab light chain 9606
234 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
235 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
236 3BN9 2 C, E E2 Fab Light Chain 9606
237 4HWE 2 L Fab light chain light chain 9606
238 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
239 5TZ2 2 L C47B222 Fab Light Chain 9606
240 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
241 4OGX 3 L DX-2930 LIGHT CHAIN 9606
242 3W9E 3 B Antibody Fab light chain 9606
243 5TFS 2 L 02-K Fab Light chain 9606
244 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
245 5E2U 1 L AT8 LIGHT CHAIN 10090
246 1OM3 1 L, M FAB 2G12, light chain light chain 9606
247 4KZE 2 L BL3-6 Fab antibody, light chain 10090
248 5WT9 2 L Light Chain of Nivolumab 9606
249 4HIJ 1 A, C Fab 023.102 light chain 9606
250 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
251 4XVU 3 D, F, J, L Antibody light chain 32630
252 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
253 3EYF 1 A, C 8f9 Fab 9606
254 3NAB 1 L Fab15 Mut6 light chain 9606
255 3IDN 1 A 2F5 Fab light chain 9606
256 5I1C 1 L FAB LIGHT CHAIN 9606
257 1RZ8 1 A, C Fab 17b light chain 9606
258 4WV1 3 A, D Fab light chain 9606
259 5EII 2 B, L Fab Light Chain 9606
260 5KNA 2 L IgG4 Light Chain 9606
261 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
262 4FNL 2 L, M Antibody C05, Light Chain 9606
263 4UB0 2 L IgG1, light chain 9606
264 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
265 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
266 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
267 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
268 5I1H 1 L FAB LIGHT CHAIN 9606
269 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
270 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
271 5I1J 1 L FAB LIGHT CHAIN 9606
272 3IDX 3 L Fab b13 light chain 9606
273 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
274 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
275 3IDJ 1 A 2F5 Fab light chain 9606
276 3IDM 1 A 2F5 Fab light chain 9606
277 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
278 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
279 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
280 4K94 1 L Fab19 heavy chain 9606
281 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
282 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
283 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
284 3D0L 1 A 2F5 heavy chain 9606
285 5KMV 2 I, L IgG4 light chain 9606
286 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
287 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
288 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
289 3X3G 2 L Light chain of KMTR2 9606
290 5E08 2 L Fab Light Chain 9606
291 2P8L 1 A nmAb 2F5, light chain 9606
292 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
293 5IBT 2 L UCA Light Chain 9606
294 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
295 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
296 1A4K 1 A, L ANTIBODY FAB FAB 10090
297 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
298 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
299 4NGH 1 L FAB LIGHT CHAIN 9606
300 4EDW 2 L tanezumab Fab light chain 9606
301 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
302 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
303 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
304 4NM4 1 L, M Antibody CR8043, Light Chain 9606
305 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
306 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
307 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
308 4D9R 2 D, L Fab light chain 9606
309 3U7W 2 L Light chain, Ig kappa chain C region 9606
310 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
311 4G7V 2 L fragment antibody light chain 9606
312 4HFW 1 A, L 6-26 Fab Light chain 9606
313 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
314 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
315 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
316 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
317 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
318 3INU 2 L, N KZ52 antibody fragment light chain 9606
319 5EU7 3 C, D FAB light chain 9606
320 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
321 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
322 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
323 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
324 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
325 4HII 1 A, C Fab 023.102 light chain 9606
326 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
327 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
328 4DN3 1 L CNTO888 LIGHT CHAIN 9606
329 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
330 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
331 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
332 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
333 3EYV 1 A, L hu3S193 Fab, light chain 10090
334 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
335 3PP3 2 K, L GA101 Fab light chain 10090
336 5IJK 3 C, D 1E03 Fab fragment light chain 9606
337 3BDY 2 L Fab Fragment -Light Chain 9606
338 5I8E 2 B, D VRC34.01 Fab light chain 9606
339 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
340 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
341 5UIX 2 L DH576 Fab light chain 9606
342 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
343 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
344 4HWB 3 L Fab light chain 9606
345 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
346 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
347 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
348 2HFG 1 L CB3s Fab light chain (kappa) 9606
349 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
350 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
351 4JQI 3 L Fab30 light chain 10090
352 3SKJ 1 L, M Antibody, light chain 9606
353 3U30 2 B, E Light chain Fab 9606
354 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
355 3U0T 1 A, C ponezumab LC Fab 9606
356 5HYS 2 B, D, F, L Uncharacterized protein 9606
357 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
358 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
359 5I15 1 L FAB LIGHT CHAIN 9606
360 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
361 5I1E 1 L FAB LIGHT CHAIN 9606
362 2NYY 2 C CR1 monoclonal antibody light chain 9606
363 2GCY 1 A huC25 fab fragment light chain 10090
364 4JLR 2 B, L Motavizumab Fab light chain 9606
365 2QQK 3 L Antibody Light Chain 9606
366 4J1U 1 A, C, E antibody 93F3 Light chain 10090
367 2PW2 1 A 2F5 Fab' heavy chain 9606
368 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
369 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
370 5SX5 1 K, L Panitumumab Fab Light Chain 9606
371 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
372 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
373 2PW1 1 A 2F5 Fab fragment heavy chain 9606
374 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
375 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
376 1TZH 2 A, L Fab YADS1 Light Chain 10090
377 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
378 4JZJ 3 B, L Fab Light Chain 10090
379 5BMF 2 L Fab fragment light chain 9606
380 5BO1 3 L, M Fab light chain 9606
381 4M6O 1 L CNTO7309 light chain 9606
382 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
383 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
384 4DVR 2 L Fab 48d Light chain 9606
385 3EYQ 1 C M2J5 Fab 9606
386 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
387 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
388 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
389 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
390 4XXD 1 A, D Fab Light Chain 9606
391 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
392 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
393 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
394 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
395 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
396 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
397 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
398 3DVG 1 A Human IgG1 fab fragment light chain 9606
399 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
400 2AGJ 1 L Yvo Fab, Light Chain 9606
401 4JKP 3 L Light chain of antibody 45-46M2 9606
402 3EYO 1 A, C 8f9 Fab 9606
403 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
404 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
405 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
406 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
407 4DN4 1 L CNTO888 LIGHT CHAIN 9606
408 5TRP 2 L DH272 Fab light chain 9606
409 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
410 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
411 2FJG 2 A, L Fab light chain 9606
412 4DKF 3 L, M FAb2 Light Chain 9606
413 5TLK 1 A, E M2177 LIGHT CHAIN 10090
414 5TLK 3 C, G H2191 LIGHT CHAIN 10090
415 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
416 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
417 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
418 3EFD 1 L FabL 10090
419 4LF3 1 A, D Fab heavy chain 10090
420 5K59 4 F, L Fab light chain 9606
421 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
422 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
423 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
424 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
425 4LEO 2 B RG7116 Fab light chain 10090
426 4G7Y 2 L Fragment antibody light chain 9606
427 4PY8 4 J antibody 3.1 light chain Fab 9606
428 3SDY 4 L Antibody CR8020, Light Chain 9606
429 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
430 3IXT 1 B, L Motavizumab Fab light chain 10090
431 2P8M 1 A nmAb 2F5, light chain 9606
432 4NP4 3 L, M bezlotoxumab light chain 9606
433 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
434 4XCE 1 B, D, L 4E10 Fab light chain 9606
435 5I1I 1 L FAB LIGHT CHAIN 9606
436 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
437 4ERS 1 L Fab light chain 9606
438 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
439 4MWF 2 B, L Fab AR3C light chain 9606
440 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
441 3SQO 3 L J16 Light chain 9606
442 4K3J 4 L Onartuzumab Fab light chain 10090
443 4PS4 1 L M1295 LIGHT CHAIN 9606
444 5GGT 3 L IGK@ protein 9606
445 3HI1 2 A, L F105 Light Chain 9606
446 4PY7 2 B, J antibody 3.1 light chain Fab 9606
447 4K8R 3 C Fab1, light chain 9606
448 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
449 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
450 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
451 1TZI 1 A Fab YADS2 Light Chain 10090
452 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
453 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
454 4X7T 2 B, L Omalizumab-Fab Light chain 9606
455 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
456 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
457 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
458 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
459 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
460 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
461 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
462 5I1G 1 L FAB LIGHT CHAIN 9606
463 2QQL 3 L Antibody Light Chain 9606
464 2P8P 1 A nmAb 2F5, light chain 9606
465 4XCC 1 L 4E10 Fab light chain 9606
466 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
467 5SX4 1 I, L Panitumumab Fab Light Chain 9606
468 3WD5 2 L Adalimumab Light Chain 9606
469 4NHC 1 L FAB LIGHT CHAIN 9606
470 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
471 5GZO 3 D, L Antibody light chain 9606
472 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
473 3U46 2 B, L CH02 Light chain Fab 9606
474 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
475 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
476 4HFU 4 L Fab 8M2 light chain 9606
477 4FP8 3 L, M, N, O Antibody C05, light chain 9606
478 4YPG 1 A, L Sifalimumab light chain 9606
479 3BE1 3 L Fab Fragment-Light Chain 9606
480 2FJH 2 A, L Fab fragment light chain 9606
481 4K9E 1 L light chain 10090
482 3U4B 2 L CH02 Light chain 9606
483 3P0V 1 L, M Fab DL11 light chain 9606
484 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
485 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
486 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
487 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
488 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
489 4KVN 3 L Human IgG Light Chain 9606
490 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
491 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
492 3OB0 1 K, L Fab 2G12, light chain Fab 9606
493 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
494 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
495 5DUM 2 L 65C6 Light Chain 9606
496 4I18 1 B, L antibody light chain Fab 10090
497 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
498 3IDY 3 C, L Fab b13 light chain 9606
499 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
500 3IVK 1 B, L Fab light chain man 10090
501 3KYK 2 L Light Chain Li33 IgG1 9606
502 5TGB 2 B, L 02-CB Fab Light Chain 9606
503 5I19 1 L FAB LIGHT CHAIN 9606
504 5TH9 1 L, M, N GS-5745 Fab light chain 9986
505 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
506 4IRZ 2 L Fab Natalizumab light chain 9606
507 5FEC 2 B, L germline 3BNC60 light chain 9606
508 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
509 5ESV 2 B, D, L CH03 Light Chain 9606
510 2R56 2 L, M IgE Fab Fragment, light chain 9606
511 1ZA6 1 A, C, E, G IGG Light chain 9606
512 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
513 4ZS6 1 D, L fab Light Chain 9606
514 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
515 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
516 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
517 5K9K 2 B, L 56.a.09 Light chain 9606
518 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
519 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
520 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
521 5CZV 3 L Fab 20350 light chain 9606
522 4P59 3 L MOR09825 Fab fragment light chain 9606
523 5CJO 3 L FAB light chain 10090
524 4LMQ 3 I, L Stromal cell-derived factor 1 9606
525 3N85 2 L Fab37 Light Chain 9606
526 3G6J 3 E, G Fab light chain 9606
527 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
528 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
529 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
530 4DKE 3 L, M FAb1.1 Light Chain 9606
531 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
532 3DRT 1 A 2F5 Fab' light chain 9606
533 5I17 1 A, L FAB LIGHT CHAIN 9606
534 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
535 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
536 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
537 4R8W 4 L Light chain of neutralizing antibody CT149 9606
538 5TPN 3 L hRSV0 light chain 9606
539 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
540 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
541 4NRY 1 B, L m66 Heavy Chain 9606
542 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
543 3S37 1 L 1121B Fab light chain 10090
544 5TZT 1 B, L Light Chain of Fab C47B161 9606
545 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
546 5JXE 2 C, F Pembrolizumab Fab light chain 9606
547 5KZC 3 D, G, L VRC01 Fab light chain 9606
548 4JM2 3 C 17b Light chain Fab 9606
549 1S78 2 C, E Pertuzumab Fab light chain 10090
550 1OP5 1 K, L FAB 2G12, light chain light chain 9606
551 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
552 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
553 5D1Z 1 A, H Y10 Light Chain 9606
554 5D1Z 3 C, E D4-10 Light Chain 9606
555 5GGR 2 B, L light chain 9606
556 5IBL 4 D, L 6639 Light Chain 9606
557 4XHJ 3 C, G Fab-RC light chain 9606
558 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
559 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
560 4N90 3 E, G, I Fab light chain 9606
561 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
562 5D1Q 1 A D2-06 Light Chain 9606
563 5D1Q 4 D P5 Light Chain 9606
564 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
565 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
566 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
567 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
568 4IOF 3 D, F Fab-bound IDE, light chain 10090
569 5FUO 3 L FAB LIGHT CHAIN 9606
570 4JHW 2 L D25 light chain 9606
571 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
572 3BQU 1 A 2F5 Fab' light chain 9606
573 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
574 4M1C 3 D, F Fab-bound IDE, light chain 9606
575 5UQY 3 C, G, K, O MR78 Fab light chain 9606
576 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
577 3ULV 2 L Fab15 light chain 9606
578 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
579 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
580 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
581 3EGS 1 A 2F5 Fab' light chain 9606
582 5D1X 1 A D4-30 Light Chain 9606
583 5D1X 4 D P5 Light Chain 9606
584 5JW3 4 L MEDI8852 light chain 9606
585 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
586 3S36 1 L 1121B light chain 10090
587 3DRO 1 A 2F5 Fab light chain 9606
588 5CWS 1 A, G sAB-158 Fab Light Chain 9606
589 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
590 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
591 2R0K 2 L antibody light chain of Fab58 9606
592 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
593 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
594 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
595 4G80 3 B, D, F, H fragment antibody light chain 9606
596 3JWO 3 L FAB 48D LIGHT CHAIN 9606
597 5CD5 3 D DRVIA7 Fab Light Chain 9606
598 3P11 2 L Fab DL11 light chain 9606
599 3F12 1 A, C M2J1 Fab 9606
600 3B2V 1 L IMC-11F8 FAB Light chain 9606
601 5IGX 3 L germline NIH45-46 light chain 9606
602 3ULU 2 L Fab15 light chain 9606
603 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
604 4XI5 3 C Fab-94 light chain 9606
605 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
606 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
607 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
608 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
609 5K9O 2 B, L 31.b.09 Light Fv 9606
610 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
611 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
612 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
613 5JW4 6 R MEDI8852 light chain 9606
614 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
615 5J3D 2 B, D, L 14N4 light chain 9606
616 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
617 5ESZ 2 B, L CH04 Light Chain 9606
618 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
619 3EFF 1 A, C FAB 10090
620 3PJS 1 A, C FAB light chain 10090
621 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
622 4ZYP 5 E, G, I AM14 antibody light chain 9606
623 5DWU 4 L Fab - Light Chain 9606
624 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9605
625 5I8H 5 F, H VRC34.01 Fab light chain 9606
626 4RQS 2 C 17b Fab Light Chain 9606
627 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
628 4R4H 3 L Antibody 2.2c, Light chain 9606
629 5FHC 5 L Antibody 114 Fab light chain 9606
630 4XMN 6 L Antibody 87 light chain 32630
631 4XMM 8 L Antibody 57 light chain 9606
632 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
633 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
634 5GZR 4 L, N Z23 Fab light chain 9606
635 5THR 4 J, K, L 17b Fab VL domain 9606
636 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
637 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
638 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
639 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
640 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
641 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
642 2ESG 1 L, M Immunoglobulin A1 light chain 9606
643 1R70 1 A, C Human IgA2(m1) Light Chain 9606
644 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606