Sequence Similarity Clusters for the Entities in PDB 1G9N

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 9 2528
95 % 6 9 3218
90 % 8 12 2377
70 % 79 120 165
50 % 79 120 196
40 % 79 120 212
30 % 79 123 222
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 21 34 715
95 % 25 39 812
90 % 25 39 851
70 % 25 39 900
50 % 25 39 947
40 % 25 39 968
30 % 25 39 962
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 35632
95 % 19 23 1474
90 % 333 482 4
70 % 1121 1583 3
50 % 2707 3846 1
40 % 2708 3847 1
30 % 3185 4574 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 34531
95 % 19 23 1470
90 % 19 23 1499
70 % 1312 1866 1
50 % 2708 3846 1
40 % 2709 3847 1
30 % 3186 4574 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4XCF 1 L 4E10 Fab light chain 9606
3 4XAW 1 L 4E10 Fab light chain 9606
4 2VXV 2 L HUMAN IGG ABT-325 9606
5 5I8C 2 B VRC34.01 Fab light chain 9606
6 4PTU 1 A Antibody pn132p2C05, light chain 9606
7 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
8 4XC3 1 L 4E10 Fab light chain 9606
9 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
10 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
11 4NWU 2 L APE1551 Ab Fab light chain 9606
12 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
13 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
14 3QQ9 1 C, L 101F LIGHT CHAIN 10090
15 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
16 3QRG 1 L Fab light chain 9606
17 3NCJ 1 L Fab15 Mut8 light chain 9606
18 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
19 4NWT 1 L APE1531 Ab Fab light chain 9606
20 3NA9 1 L Fab15 light chain 9606
21 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
22 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
23 4HHA 1 A Fab KE5 Fab fragment KE5 9606
24 3NAA 1 L Fab15 Mut5 light chain 9606
25 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
26 4PUB 2 L DX-2930 LIGHT CHAIN 9606
27 3OAZ 2 K, L Fab 2G12, light chain 9606
28 3EO0 1 A, C GC-1008 Fab Light Chain 10090
29 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
30 4JHA 2 L D25 light chain 9606
31 4PTT 1 A Antibody pn132p2C05, light chain 9606
32 4DGV 2 L HCV1 Light Chain 9606
33 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
34 3IU4 2 L chP3 Fab light chain 10090
35 3P0Y 3 L Fab DL11 light chain 9606
36 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
37 3NAC 1 L Fab15 Mut7 light chain 9606
38 4DGY 2 L HCV1 Light Chain 9606
39 3MXW 2 L 5E1 light chain 9606
40 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
41 3EO9 1 L Efalizumab Fab fragment, light chain 9606
42 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
43 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
44 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
45 2FX7 1 L Fab 4E10 Light Chain 9606
46 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
47 5I18 1 L FAB LIGHT CHAIN 9606
48 3SOB 1 L antibody light chain 9606
49 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
50 4KQ3 1 L CNTO3186 light chain Fab 9606
51 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
52 4I77 2 L Lebrikizumab light chain Fab 9606
53 4HJG 1 A Trastuzumab light chain 9606
54 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
55 3FN0 1 L Fab Z13e1 light chain 9606
56 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
57 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
58 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
59 4MAU 1 L C2244 light chain SEE REMARK 999 10090
60 1OP3 1 K, L FAB 2G12, light chain light chain 9606
61 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
62 3QWO 1 B, L motavizumab light chain 10090
63 4IOI 1 A Trastuzumab light chain 9606
64 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
65 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
66 5F9O 3 L CH235.09 Light chain 9606
67 4RBP 1 K, L Fab 2G12 light chain 9606
68 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
69 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
70 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
71 3OAY 1 K, L Fab 2G12, light chain 9606
72 3TCL 2 B, L CH04 Light Chain Fab 9606
73 5F7E 2 L Fab light chain 9606
74 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
75 5FHA 2 L Antibody 114 Fab light chain 9606
76 4X7S 2 L Ig kappa chain C region residues 23-236 9606
77 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
78 5E8E 1 A IGA FAB LIGHT CHAIN 9606
79 2HFF 1 A, L CB2 Fab, light chain 9606
80 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
81 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
82 3L5X 1 L H2L6 LIGHT CHAIN 9606
83 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
84 2R8S 2 L Fab light chain 10090
85 4HKZ 1 A Trastuzumab light chain 9606
86 3SO3 2 B A11 FAB light chain 9606
87 3IDG 1 A 2F5 Fab light chain 9606
88 3OAU 2 L Fab 2G12, light chain 9606
89 4WY7 2 L Fab 4E10Light chain 9606
90 4ZYK 2 B, L AM14 light chain 9606
91 4HIE 1 A Fab 023.102 9606
92 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
93 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
94 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
95 4KMT 1 L light chain O12/KAPPA Fab 9606
96 3NZH 1 L 5F6 LIGHT CHAIN 10090
97 1RHH 1 A, C Fab X5, light chain 9606
98 1TJG 1 L FAB 2F5 Light Chain 9606
99 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
100 4XTR 3 D, F Antibody Light chain 32630
101 1RZ7 1 L Fab 48d light chain 9606
102 1RZG 2 B, D Fab 412d heavy chain 9606
103 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
104 3PGF 3 L SAB Light Chain 9606
105 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
106 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
107 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
108 2QQN 3 L Antibody light chain 9606
109 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
110 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
111 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
112 3X3F 2 L Light chain of KMTR2 9606
113 2CMR 3 L D5 9606
114 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
115 3GRW 2 L Fab light chain 9606
116 5I1D 1 A, L FAB LIGHT CHAIN 9606
117 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
118 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
119 4LKC 1 A Fab fragment of PCSK9 antibody 9606
120 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
121 4KZD 2 L BL3-6 Fab antibody, light chain 10090
122 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
123 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
124 4HIH 1 A, C Fab 023.102 9606
125 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
126 3DRQ 1 A 2F5 Fab' light chain 9606
127 5IES 2 L VRC01cHuGL2 Fab light chain 9606
128 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
129 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
130 3D0V 1 A 2F5 Fab heavy chain 9606
131 3S34 1 L 1121B Fab light chain 10090
132 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
133 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
134 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
135 2AJ3 1 A, C, E Fab m18, Light Chain 9606
136 3IDI 1 A 2F5 Fab light chain 9606
137 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
138 4NRX 3 B, E, L m66 Light Chain 9606
139 3O2D 1 L ibalizumab light chain 10090
140 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
141 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
142 2R0L 1 L antibody light chain 32630
143 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
144 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
145 3Q1S 1 L Z13e1 Fab light chain 9606
146 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
147 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
148 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
149 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
150 3KR3 3 L antibody-Fab (light chain) 9606
151 5DK3 1 A, F Light Chain 9606
152 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
153 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
154 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
155 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
156 4D9Q 2 D, L Anti-Factor D, light chain 9606
157 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
158 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
159 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
160 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
161 2FX9 1 L, M Fab 4E10 Light Chain 9606
162 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
163 1TZG 1 L, M Fab 4E10 light chain 9606
164 3W9D 2 B, D Antibody Fab light chain 9606
165 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
166 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
167 3BN9 2 C, E E2 Fab Light Chain 9606
168 4HWE 2 L Fab light chain light chain 9606
169 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
170 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
171 4OGX 3 L DX-2930 LIGHT CHAIN 9606
172 3W9E 3 B Antibody Fab light chain 9606
173 1OM3 1 L, M FAB 2G12, light chain light chain 9606
174 4KZE 2 L BL3-6 Fab antibody, light chain 10090
175 4HIJ 1 A, C Fab 023.102 light chain 9606
176 4XVU 3 D, F, J, L Antibody light chain 32630
177 3EYF 1 A, C 8f9 Fab 9606
178 3NAB 1 L Fab15 Mut6 light chain 9606
179 3IDN 1 A 2F5 Fab light chain 9606
180 1RZ8 1 A, C Fab 17b light chain 9606
181 4WV1 3 A, D Fab light chain 9606
182 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
183 4FNL 2 L, M Antibody C05, Light Chain 9606
184 4UB0 2 L IgG1, light chain 9606
185 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
186 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
187 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
188 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
189 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
190 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
191 3IDX 3 L Fab b13 light chain 9606
192 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
193 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
194 3IDJ 1 A 2F5 Fab light chain 9606
195 3IDM 1 A 2F5 Fab light chain 9606
196 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
197 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
198 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
199 4K94 1 L Fab19 heavy chain 9606
200 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
201 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
202 3D0L 1 A 2F5 heavy chain 9606
203 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
204 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
205 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
206 3X3G 2 L Light chain of KMTR2 9606
207 2P8L 1 A nmAb 2F5, light chain 9606
208 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN FAB FRAGMENT 10090
209 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
210 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
211 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
212 4NGH 1 L FAB LIGHT CHAIN 9606
213 4EDW 2 L tanezumab Fab light chain 9606
214 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
215 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
216 4NM4 1 L, M Antibody CR8043, Light Chain 9606
217 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
218 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
219 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
220 4D9R 2 D, L Fab light chain 9606
221 3U7W 2 L Light chain, Ig kappa chain C region 9606
222 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
223 4G7V 2 L fragment antibody light chain 9606
224 4HFW 1 A, L 6-26 Fab Light chain 9606
225 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
226 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
227 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
228 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
229 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
230 3INU 2 L, N KZ52 antibody fragment light chain 9606
231 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
232 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
233 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
234 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
235 4HII 1 A, C Fab 023.102 light chain 9606
236 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
237 4DN3 1 L CNTO888 LIGHT CHAIN 9606
238 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
239 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
240 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
241 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
242 3EYV 1 A, L hu3S193 Fab, light chain 10090
243 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
244 3BDY 2 L Fab Fragment -Light Chain 9606
245 5I8E 2 B, D VRC34.01 Fab light chain 9606
246 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
247 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
248 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
249 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
250 4HWB 3 L Fab light chain 9606
251 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
252 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
253 2HFG 1 L CB3s Fab light chain (kappa) 9606
254 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
255 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
256 4JQI 3 L Fab30 light chain 10090
257 3SKJ 1 L, M Antibody, light chain 9606
258 3U30 2 B, E Light chain Fab 9606
259 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
260 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
261 2NYY 2 C CR1 monoclonal antibody light chain 9606
262 2GCY 1 A huC25 fab fragment light chain 10090
263 4JLR 2 B, L Motavizumab Fab light chain 9606
264 2QQK 3 L Antibody Light Chain 9606
265 4J1U 1 A, C, E antibody 93F3 Light chain 10090
266 2PW2 1 A 2F5 Fab' heavy chain 9606
267 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
268 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
269 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
270 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
271 2PW1 1 A 2F5 Fab fragment heavy chain 9606
272 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
273 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
274 1TZH 2 A, L Fab YADS1 Light Chain 10090
275 4JZJ 3 B, L Fab Light Chain 10090
276 5BO1 3 L, M Fab light chain 9606
277 4M6O 1 L CNTO7309 light chain 9606
278 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
279 4DVR 2 L Fab 48d Light chain 9606
280 3EYQ 1 C M2J5 Fab 9606
281 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
282 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
283 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
284 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
285 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
286 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
287 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
288 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
289 3DVG 1 A Human IgG1 fab fragment light chain 9606
290 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
291 2AGJ 1 L Yvo Fab, Light Chain 9606
292 4JKP 3 L Light chain of antibody 45-46M2 9606
293 3EYO 1 A, C 8f9 Fab 9606
294 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
295 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
296 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
297 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
298 4DN4 1 L CNTO888 LIGHT CHAIN 9606
299 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
300 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
301 2FJG 2 A, L Fab light chain 9606
302 4DKF 3 L, M FAb2 Light Chain 9606
303 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
304 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
305 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
306 3EFD 1 L FabL 10090
307 4LF3 1 A, D Fab heavy chain 10090
308 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
309 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
310 4LEO 2 B RG7116 Fab light chain 10090
311 4G7Y 2 L Fragment antibody light chain 9606
312 4PY8 4 J antibody 3.1 light chain Fab 9606
313 3SDY 4 L Antibody CR8020, Light Chain 9606
314 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
315 3IXT 1 B, L Motavizumab Fab light chain 10090
316 2P8M 1 A nmAb 2F5, light chain 9606
317 4NP4 3 L, M bezlotoxumab light chain 9606
318 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
319 4XCE 1 B, D, L 4E10 Fab light chain 9606
320 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
321 4ERS 1 L Fab light chain 9606
322 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
323 4MWF 2 B, L Fab AR3C light chain 9606
324 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
325 3SQO 3 L J16 Light chain 9606
326 4K3J 4 L Onartuzumab Fab light chain 10090
327 4PS4 1 L M1295 LIGHT CHAIN 9606
328 3HI1 2 A, L F105 Light Chain 9606
329 4PY7 2 B, J antibody 3.1 light chain Fab 9606
330 4K8R 3 C Fab1, light chain 9606
331 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
332 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
333 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
334 1TZI 1 A Fab YADS2 Light Chain 10090
335 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
336 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
337 4X7T 2 B, L Omalizumab-Fab Light chain 9606
338 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
339 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
340 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
341 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
342 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
343 2QQL 3 L Antibody Light Chain 9606
344 2P8P 1 A nmAb 2F5, light chain 9606
345 4XCC 1 L 4E10 Fab light chain 9606
346 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
347 3WD5 2 L Adalimumab Light Chain 9606
348 4NHC 1 L FAB LIGHT CHAIN 9606
349 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
350 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
351 3U46 2 B, L CH02 Light chain Fab 9606
352 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
353 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
354 4HFU 4 L Fab 8M2 light chain 9606
355 4FP8 3 L, M, N, O Antibody C05, light chain 9606
356 4YPG 1 A, L Sifalimumab light chain 9606
357 3BE1 3 L Fab Fragment-Light Chain 9606
358 2FJH 2 A, L Fab fragment light chain 9606
359 4K9E 1 L light chain 10090
360 3U4B 2 L CH02 Light chain 9606
361 3P0V 1 L, M Fab DL11 light chain 9606
362 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
363 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
364 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
365 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
366 4KVN 3 L Human IgG Light Chain 9606
367 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
368 3OB0 1 K, L Fab 2G12, light chain Fab 9606
369 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
370 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
371 5DUM 2 L 65C6 Light Chain 9606
372 4I18 1 B, L antibody light chain Fab 10090
373 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
374 3IDY 3 C, L Fab b13 light chain 9606
375 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
376 3IVK 1 B, L Fab light chain man 10090
377 3KYK 2 L Light Chain Li33 IgG1 9606
378 4IRZ 2 L Fab Natalizumab light chain 9606
379 5FEC 2 B, L germline 3BNC60 light chain 9606
380 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
381 5ESV 2 B, D, L CH03 Light Chain 9606
382 2R56 2 L, M IgE Fab Fragment, light chain 9606
383 1ZA6 1 A, C, E, G IGG Light chain 9606
384 4ZS6 1 D, L fab Light Chain 9606
385 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
386 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
387 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
388 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
389 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
390 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
391 4P59 3 L MOR09825 Fab fragment light chain 9606
392 4LMQ 3 I, L Stromal cell-derived factor 1 9606
393 3N85 2 L Fab37 Light Chain 9606
394 3G6J 3 E, G Fab light chain 9606
395 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
396 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
397 4DKE 3 L, M FAb1.1 Light Chain 9606
398 3DRT 1 A 2F5 Fab' light chain 9606
399 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
400 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
401 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
402 4R8W 4 L Light chain of neutralizing antibody CT149 9606
403 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
404 4NRY 1 B, L m66 Heavy Chain 9606
405 3S37 1 L 1121B Fab light chain 10090
406 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
407 4JM2 3 C 17b Light chain Fab 9606
408 1S78 2 C, E Pertuzumab Fab light chain 10090
409 1OP5 1 K, L FAB 2G12, light chain light chain 9606
410 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
411 4XHJ 3 C, G Fab-RC light chain 9606
412 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
413 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
414 4N90 3 E, G, I Fab light chain 9606
415 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
416 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
417 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
418 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
419 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
420 4IOF 3 D, F Fab-bound IDE, light chain 10090
421 4JHW 2 L D25 light chain 9606
422 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
423 3BQU 1 A 2F5 Fab' light chain 9606
424 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
425 4M1C 3 D, F Fab-bound IDE, light chain 9606
426 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
427 3ULV 2 L Fab15 light chain 9606
428 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
429 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
430 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
431 3EGS 1 A 2F5 Fab' light chain 9606
432 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
433 3S36 1 L 1121B light chain 10090
434 3DRO 1 A 2F5 Fab light chain 9606
435 5CWS 1 A, G sAB-158 Fab Light Chain 9606
436 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
437 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
438 2R0K 2 L antibody light chain of Fab58 9606
439 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
440 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
441 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
442 4G80 3 B, D, F, H fragment antibody light chain 9606
443 3X2D 3 C, G, K, O Fab light chain 9606
444 3JWO 3 L FAB 48D LIGHT CHAIN 9606
445 5CD5 3 D DRVIA7 Fab Light Chain 9606
446 3P11 2 L Fab DL11 light chain 9606
447 3F12 1 A, C M2J1 Fab 9606
448 3B2V 1 L IMC-11F8 FAB Light chain 9606
449 5IGX 3 L germline NIH45-46 light chain 9606
450 3ULU 2 L Fab15 light chain 9606
451 4XI5 3 C Fab-94 light chain 9606
452 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
453 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
454 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
455 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
456 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
457 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
458 5ESZ 2 B, L CH04 Light Chain 9606
459 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
460 3EFF 1 A, C FAB 10090
461 3PJS 1 A, C FAB light chain 10090
462 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
463 4ZYP 5 E, G, I AM14 antibody light chain 9606
464 5DWU 4 L Fab - Light Chain 9606
465 5I8H 5 F, H VRC34.01 Fab light chain 9606
466 4RQS 2 C 17b Fab Light Chain 9606
467 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
468 4R4H 3 L Antibody 2.2c, Light chain 9606
469 5FHC 5 L Antibody 114 Fab light chain 9606
470 4XMN 6 L Antibody 87 light chain 32630
471 4XMM 8 L Antibody 57 light chain 9606
472 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
473 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
474 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
475 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
476 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
477 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
478 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
479 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
480 2ESG 1 L, M Immunoglobulin A1 light chain 9606
481 1R70 1 A, C Human IgA2(m1) Light Chain 9606
482 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606