Sequence Similarity Clusters for the Entities in PDB 1G9N

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 7 10 3437
95 % 8 11 3587 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 1.0
PDBFlex
90 % 9 13 2983
70 % 89 192 130
50 % 89 192 157
40 % 89 192 168
30 % 89 195 184
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 23 40 854
95 % 25 46 804 Flexibility: Low
Max RMSD: 2.4, Avg RMSD: 1.2
PDBFlex
90 % 25 46 836
70 % 25 46 887
50 % 25 46 935
40 % 25 46 960
30 % 25 46 943
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 3 17453
95 % 22 34 1108 Flexibility: Low
Max RMSD: 5.3, Avg RMSD: 1.2
PDBFlex
90 % 581 844 2
70 % 1838 2696 1
50 % 3738 5473 1
40 % 4231 6175 1
30 % 5229 7653 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 19 26 1209
95 % 19 26 1446 Flexibility: Low
Max RMSD: 3.9, Avg RMSD: 1.0
PDBFlex
90 % 19 26 1473
70 % 1807 2655 2
50 % 3739 5473 1
40 % 4232 6175 1
30 % 5230 7653 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 6MEE 2 B, D antibody HEPC74 Light Chain 9606
4 6BJZ 2 L 5c8 Fab Light chain 9606
5 4XCF 1 L 4E10 Fab light chain 9606
6 5X08 2 L Fab 4E10 Light chain 9606
7 4XAW 1 L 4E10 Fab light chain 9606
8 5UCB 2 L Fab Light Chain 9606
9 2VXV 2 L HUMAN IGG ABT-325 9606
10 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
11 5I8C 2 B VRC34.01 Fab light chain 9606
12 5WK2 1 L M116 LIGHT CHAIN 9606
13 3PP4 2 L GA101 Fab light chain 10090
14 4PTU 1 A Antibody pn132p2C05, light chain 9606
15 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
16 4XC3 1 L 4E10 Fab light chain 9606
17 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
18 5VSI 2 L CH1/Ckappa Fab light chain 9606
19 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
20 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
21 4NWU 2 L APE1551 Ab Fab light chain 9606
22 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
23 5EWI 2 L VRC38.01 Light Chain 9606
24 5E2W 1 L AT8 LIGHT CHAIN 10090
25 5E2V 1 L AT8 LIGHT CHAIN 10090
26 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
27 6CA7 1 L PCT64_13C light chain 9606
28 5OB5 3 L fAb Light chain 9606
29 3QQ9 1 C, L 101F LIGHT CHAIN 10090
30 5I1K 1 L FAB LIGHT CHAIN 9606
31 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
32 5V7U 1 L CBTAU-22.1 Fab light chain 9606
33 5UEA 3 B, L Fab Light Chain 9606
34 5NMV 1 L Fab light chain 10088
35 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
36 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
37 3QRG 1 L Fab light chain 9606
38 3NCJ 1 L Fab15 Mut8 light chain 9606
39 5W05 1 L M59 FAB LIGHT CHAIN 10090
40 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
41 1UM5 1 L Antibody 21H3 L chain 10090
42 4NWT 1 L APE1531 Ab Fab light chain 9606
43 3NA9 1 L Fab15 light chain 9606
44 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
45 4LRI 1 A, B MSL-109 Light Chain 9606
46 4JN2 1 A, L anti dabigatran Fab 10090
47 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
48 5U6A 1 A Light Chain 9606
49 4HHA 1 A Fab KE5 Fab fragment KE5 9606
50 5UEK 3 L Fab 12E Light Chain 9606
51 3NAA 1 L Fab15 Mut5 light chain 9606
52 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
53 5IK3 2 B, D 1E03 Fab fragment light chain 9606
54 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
55 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
56 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
57 5IT2 2 L light chain 9606
58 6DW2 1 A 6078 Fab light chain 9606
59 6BQB 1 L MGG4 Fab light chain 9606
60 4PUB 2 L DX-2930 LIGHT CHAIN 9606
61 6B14 2 L Light chain of Fab BL3-6S97N 10090
62 5VKD 3 L Fab light chain 9606
63 5XHG 1 A, C polypeptide(L) 10090
64 3OAZ 2 K, L Fab 2G12, light chain 9606
65 4YGV 2 B, L aDabi-Fab2a light chain 9606
66 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
67 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
68 3EO0 1 A, C GC-1008 Fab Light Chain 10090
69 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
70 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
71 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
72 4JHA 2 L D25 light chain 9606
73 6B9Z 1 A Trastuzumab Fab light chain 10090
74 4PTT 1 A Antibody pn132p2C05, light chain 9606
75 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
76 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
77 4DGV 2 L HCV1 Light Chain 9606
78 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
79 3IU4 2 L chP3 Fab light chain 10090
80 3P0Y 3 L Fab DL11 light chain 9606
81 6ANA 3 L LL2 Fab Light Chain 10090
82 5IBU 1 B, L 6652 Light Chain 9606
83 6AOD 1 A FXIa Antibody FAB Light Chain 9606
84 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
85 6ELE 2 B, L fAB light chain 9606
86 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
87 3NAC 1 L Fab15 Mut7 light chain 9606
88 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
89 4YHO 2 L aDabi-Fab3 light chain 9606
90 4DGY 2 L HCV1 Light Chain 9606
91 3MXW 2 L 5E1 light chain 9606
92 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
93 3EO9 1 L Efalizumab Fab fragment, light chain 9606
94 6N35 1 K, L Fab 2G12 light chain 9606
95 5WUV 1 L light chain 9606
96 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
97 6B0G 1 C 1245 Antibody, Light Chain 9606
98 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
99 6BAH 1 A Trastuzumab Fab light chain,Immunoglobulin kappa constant 10090
100 6D0X 2 B 1210 Antibody, light chain 9606
101 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
102 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
103 5TL5 1 L M2177 LIGHT CHAIN 10090
104 2FX7 1 L Fab 4E10 Light Chain 9606
105 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
106 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
107 5XKU 2 B HNIgGA6 light chain 9606
108 5I18 1 L FAB LIGHT CHAIN 9606
109 4JN1 2 L anti-dabigatran Fab1, light chain 10090
110 6HKG 2 B FISW84 Fab Fragment Light Chain 9606
111 3SOB 1 L antibody light chain 9606
112 6B5M 2 L CIS43 Fab Light chain 9606
113 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
114 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
115 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
116 5DR5 2 L AbD09097 Fab light chain 9606
117 4KQ3 1 L CNTO3186 light chain Fab 9606
118 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
119 4I77 2 L Lebrikizumab light chain Fab 9606
120 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
121 4HJG 1 A Trastuzumab light chain 9606
122 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
123 3FN0 1 L Fab Z13e1 light chain 9606
124 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
125 4YHI 2 B, L aDabi-Fab2a light chain 9606
126 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
127 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
128 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
129 6ELJ 2 B, L fAB light chain 9606
130 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
131 4MAU 1 L C2244 light chain SEE REMARK 999 10090
132 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
133 4LKX 2 B Fab fragment light chain 9606
134 5JW5 2 B, L MEDI8852 Light chain 9606
135 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
136 3QWO 1 B, L motavizumab light chain 10090
137 4IOI 1 A Trastuzumab light chain 9606
138 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
139 6GHG 2 B, L Fab light chain 9606
140 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
141 5VAG 2 B Light chain of antibody m826 9606
142 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
143 5I16 1 A, L FAB LIGHT CHAIN 9606
144 5F9O 3 L CH235.09 Light chain 9606
145 1UM4 1 L Antibody 21H3 L chain 10090
146 4RBP 1 K, L Fab 2G12 light chain 9606
147 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
148 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
149 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
150 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
151 5GGQ 1 L nivolumab light chain 9606
152 6B5N 2 L CIS43 Fab Light chain 9606
153 3OAY 1 K, L Fab 2G12, light chain 9606
154 6AND 3 L Pinatuzumab Fab light chain 9606
155 5K9J 2 L 56.a.09 light chain 9606
156 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
157 5TF1 2 L O2-CC Fab Light Chain 9606
158 3TCL 2 B, L CH04 Light Chain Fab 9606
159 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
160 5F7E 2 L Fab light chain 9606
161 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
162 5FHA 2 L Antibody 114 Fab light chain 9606
163 5UMN 3 D, F Antibody C05, light chain 9606
164 4X7S 2 L Ig kappa chain C region residues 23-236 9606
165 1UM6 1 L antibody 21h3, L chain 10090
166 4X0K 2 B, L Fab fragment light chain 9606
167 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
168 5E8E 1 A IGA FAB LIGHT CHAIN 9606
169 6ELL 2 B, L fAB light chain 9606
170 2HFF 1 A, L CB2 Fab, light chain 9606
171 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
172 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
173 5GGS 2 B, D light chain 9606
174 6DG2 2 B, D 6D6 Fab light chain 10090
175 5I1L 1 A, L FAB LIGHT CHAIN 9606
176 5GGV 1 L light chain 9606
177 3L5X 1 L H2L6 LIGHT CHAIN 9606
178 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
179 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
180 2R8S 2 L Fab light chain 10090
181 4HKZ 1 A Trastuzumab light chain 9606
182 6DB8 3 L Fab-Light chain 32630
183 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
184 6MEH 3 L antibody HEPC74 Light Chain 9606
185 3SO3 2 B A11 FAB light chain 9606
186 3OAU 2 L Fab 2G12, light chain 9606
187 5WEQ 1 A MR78 mutant light chain 9606
188 4WY7 2 L Fab 4E10Light chain 9606
189 4ZYK 2 B, L AM14 light chain 9606
190 6DWA 1 A, L 4497 Fab Light Chain 9606
191 6C9U 2 L Light chain of Fab 1B2 9606
192 5E94 1 A, C Antibody Fab fragment light chain 10090
193 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
194 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
195 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
196 4HIE 1 A Fab 023.102 9606
197 4LEX 1 L FAB HEAVY CHAIN 10090
198 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
199 6MED 2 B, D, I antibody HEPC3 Light Chain 9606
200 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
201 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
202 5Y11 2 B MAb 4-5 light chain 9606
203 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
204 4KMT 1 L light chain O12/KAPPA Fab 9606
205 3NZH 1 L 5F6 LIGHT CHAIN 10090
206 1RHH 1 A, C Fab X5, light chain 9606
207 6CW3 2 B, D antibody light chain 9606
208 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
209 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
210 4XTR 3 D, F Antibody Light chain 32630
211 1RZ7 1 L Fab 48d light chain 9606
212 1RZG 2 B, D Fab 412d heavy chain 9606
213 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
214 3PGF 3 L SAB Light Chain 9606
215 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
216 6DFJ 2 L anti-Zika antibody Z021, Light Chain 9606
217 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
218 4YHL 2 L aDabi-Fab2b light chain 9606
219 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
220 6B9Y 1 A Trastuzumab Fab light chain 9606
221 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
222 2QQN 3 L Antibody light chain 9606
223 6MSY 1 L Fab 2G12, light chain 9606
224 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
225 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
226 6BAE 1 A Trastuzumab Fab light chain 10090
227 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
228 4YHM 2 L aDabi-Fab2b light chain 9606
229 6H0E 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF dmCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
230 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
231 3X3F 2 L Light chain of KMTR2 9606
232 2CMR 3 L D5 9606
233 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
234 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
235 5CZX 3 D, L 20358 Fab light chain 9606
236 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
237 3GRW 2 L Fab light chain 9606
238 6B3K 2 L Light chain of Fab BL3-6 10090
239 6C6Z 3 D, L Antibody CDC2-C2 light chain 9606
240 5I1D 1 A, L FAB LIGHT CHAIN 9606
241 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
242 6AYZ 2 C, D Fab Light Chain 9606
243 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
244 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
245 6CDO 2 B vFP16.02 Fab light chain 10090
246 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
247 5DRX 2 B, L CLL240 BCR light chain 9606
248 4HIX 2 L Humanized 3D6 Fab light chain 10090
249 4LKC 1 A Fab fragment of PCSK9 antibody 9606
250 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
251 4KZD 2 L BL3-6 Fab antibody, light chain 10090
252 4HCR 2 L, N PF-547659 light chain 9606
253 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
254 4HIH 1 A, C Fab 023.102 9606
255 4YHK 2 L aDabi-Fab2a light chain 9606
256 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
257 5IES 2 L VRC01cHuGL2 Fab light chain 9606
258 4UV7 3 L GC1118A 9606
259 5TKJ 2 B, E, H, K vFP1.01 chimeric mouse antibody light chain 10090
260 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
261 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
262 3S34 1 L 1121B Fab light chain 10090
263 6AZX 2 B, D 663 antibody, light chain 9606
264 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
265 5E2T 1 L AT8 LIGHT CHAIN 10090
266 6EMJ 2 B, L fAb light chain 9606
267 5W1G 2 L CR1-07 Fab light chain 9606
268 6CNR 1 L Aducanumab light chain 9606
269 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
270 2AJ3 1 A, C, E Fab m18, Light Chain 9606
271 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
272 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
273 4NRX 3 B, E, L m66 Light Chain 9606
274 3O2D 1 L ibalizumab light chain 10090
275 6DB9 3 L Fab-Light-Chain 32630
276 6DDV 3 A Anti-MICA Fab fragment light chain clone 6E1 10090
277 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
278 5O14 3 D, L Fab 1A12 Light Chain 9606
279 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
280 5V7R 1 L CBTAU-7.1 Fab light chain 9606
281 6B5O 2 L CIS43 Fab Light chain 9606
282 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
283 2R0L 1 L antibody light chain 32630
284 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
285 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
286 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
287 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
288 6N32 1 L, M Fab 2G12 light chain 9606
289 3Q1S 1 L Z13e1 Fab light chain 9606
290 6DWC 1 A, L 4497 Fab Light Chain 9606
291 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
292 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
293 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
294 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
295 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
296 5OD8 2 B B2 Fab fragment - Light chain 9606
297 3KR3 3 L antibody-Fab (light chain) 9606
298 5DK3 1 A, F Light Chain 9606
299 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
300 6DZN 1 L Antibody ADI-15878, light chain 9606
301 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
302 4YHN 2 B, L aDabi-Fab3 light chain 9606
303 5GGU 2 B, L light chain 9606
304 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
305 4D9Q 2 D, L Anti-Factor D, light chain 9606
306 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
307 5KW9 3 L IgA Light chain 9606
308 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
309 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
310 5W2B 2 L Fab Light Chain 9606
311 5DRW 2 B CLL183 BCR antibody light chain 9606
312 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
313 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
314 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
315 5MVZ 2 B, L Fab 4AB007 L-chain 9606
316 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
317 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
318 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
319 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
320 2FX9 1 L, M Fab 4E10 Light Chain 9606
321 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
322 6AXL 1 B, C Fab317 light chains 9606
323 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
324 1TZG 1 L, M Fab 4E10 light chain 9606
325 3W9D 2 B, D Antibody Fab light chain 9606
326 6CO3 1 L Fab light chain 9606
327 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
328 3BN9 2 C, E E2 Fab Light Chain 9606
329 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
330 4HWE 2 L Fab light chain light chain 9606
331 6DF0 1 L 4G10-4D5 Antibody Light chain 32630
332 6DF1 1 L Anti-phosphotyrosine antibody 4G10-4D5 heavy chain 9606
333 5TZ2 2 L C47B222 Fab Light Chain 9606
334 6MLK 2 L Light chain of Fab 3A6 9606
335 6CDM 2 B, E vFP7.04 light chain 10090
336 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
337 4OGX 3 L DX-2930 LIGHT CHAIN 9606
338 3W9E 3 B Antibody Fab light chain 9606
339 5TFS 2 L 02-K Fab Light chain 9606
340 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
341 5E2U 1 L AT8 LIGHT CHAIN 10090
342 4KZE 2 L BL3-6 Fab antibody, light chain 10090
343 5WT9 2 L Light Chain of Nivolumab 9606
344 4HIJ 1 A, C Fab 023.102 light chain 9606
345 6MU3 1 K, L Fab 2G12, light chain 9606
346 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
347 4XVU 3 D, F, J, L Antibody light chain 32630
348 5B71 1 A, C SKY59 Fab light chain 9606
349 6BF4 3 C, L VRC-PG05 Fab light chain 9606
350 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
351 3EYF 1 A, C 8f9 Fab 9606
352 3NAB 1 L Fab15 Mut6 light chain 9606
353 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
354 5I1C 1 L FAB LIGHT CHAIN 9606
355 5VZY 2 L Crenezumab Fab light chain,Immunoblobulin light chain 9606
356 5WNA 2 D, L mAb 3D3 Fab light chain 9606
357 1RZ8 1 A, C Fab 17b light chain 9606
358 4WV1 3 A, D Fab light chain 9606
359 6ANP 1 A, L CAT192 Fab Light chain 9606
360 5EII 2 B, L Fab Light Chain 9606
361 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
362 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
363 4FNL 2 L, M Antibody C05, Light Chain 9606
364 4UB0 2 L IgG1, light chain 9606
365 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
366 1BJ1 1 J, L Fab fragment, light chain HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
367 5I1H 1 L FAB LIGHT CHAIN 9606
368 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
369 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
370 6BFT 1 B, L Avastin Light Chain Fab fragment mutant 9606
371 6DFI 2 L anti-Zika antibody Z021, Light Chain 9606
372 5I1J 1 L FAB LIGHT CHAIN 9606
373 3IDX 3 L Fab b13 light chain 9606
374 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
375 6AO0 1 L CAT192 Fab Light chain 9606
376 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
377 4K94 1 L Fab19 heavy chain 9606
378 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
379 6B5L 2 L CIS43 Fab Light Chain 9606
380 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
381 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
382 5XAJ 2 B, L FabHM14c10 light chain 9606
383 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
384 5VEB 2 B, L anti-CDH6 Fab light chain 9606
385 5VZX 2 I, L Crenezumab Fab light chain 9606
386 6DWI 1 A, C, E, G, I, K, M, O 4462 Fab Light Chain 9606
387 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
388 3X3G 2 L Light chain of KMTR2 9606
389 5WAW 1 L fAb Light Chain 9606
390 5E08 2 L Fab Light Chain 9606
391 6AZ2 3 E, F Fab Light Chain 9606
392 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
393 5IBT 2 L UCA Light Chain 9606
394 6CA6 1 A, L PCT64_35S light chain 9606
395 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
396 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
397 1A4K 1 A, L ANTIBODY FAB FAB 10090
398 6DF2 1 A, L Anti-phosphotyrosine antibody c310-4D5 heavy chain 32630
399 5MO9 2 L AB20 Fab light chain 10090
400 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
401 5XRQ 2 B, L Fab H3v-47 light chain 9606
402 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
403 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
404 4NGH 1 L FAB LIGHT CHAIN 9606
405 5WB9 3 L N60P23 Fab light chain 9606
406 4EDW 2 L tanezumab Fab light chain 9606
407 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
408 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
409 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
410 4NM4 1 L, M Antibody CR8043, Light Chain 9606
411 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
412 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
413 4D9R 2 D, L Fab light chain 9606
414 3U7W 2 L Light chain, Ig kappa chain C region 9606
415 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
416 4G7V 2 L fragment antibody light chain 9606
417 5W06 2 L M1587 FAB LIGHT CHAIN 10090
418 4HFW 1 A, L 6-26 Fab Light chain 9606
419 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
420 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
421 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
422 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
423 5JO4 2 B D80 Fab Light Chain 9606
424 5JO4 4 D G6 Fab Light Chain 9606
425 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
426 3INU 2 L, N KZ52 antibody fragment light chain 9606
427 5EU7 3 C, D FAB light chain 9606
428 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
429 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
430 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
431 6CDP 2 B vFP20.01 Fab light chain 10090
432 5X8M 3 C durvalumab light chain 9606
433 6AMJ 1 A, L CAT192 Fab light chain 9606
434 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
435 4HII 1 A, C Fab 023.102 light chain 9606
436 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
437 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
438 4DN3 1 L CNTO888 LIGHT CHAIN 9606
439 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
440 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
441 5WNB 2 L, M mAb 3D3 Fab light chain 9606
442 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
443 3EYV 1 A, L hu3S193 Fab, light chain 10090
444 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
445 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
446 3PP3 2 K, L GA101 Fab light chain 10090
447 5IJK 3 C, D 1E03 Fab fragment light chain 9606
448 3BDY 2 L Fab Fragment -Light Chain 9606
449 5I8E 2 B, D VRC34.01 Fab light chain 9606
450 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
451 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
452 5UIX 2 L DH576 Fab light chain 9606
453 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
454 6MFT 2 B, L Light chain glVRC01 9606
455 4HWB 3 L Fab light chain 9606
456 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
457 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
458 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
459 2HFG 1 L CB3s Fab light chain (kappa) 9606
460 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
461 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
462 5ZIA 2 B, E, I, L, M, P Light chain (kappa) of CBTAU-24.1 antibody 9606
463 4JQI 3 L Fab30 light chain 10090
464 6B0H 3 A, C 1262 antibody, light chain 9606
465 3SKJ 1 L, M Antibody, light chain 9606
466 3U30 2 B, E Light chain Fab 9606
467 6B0A 2 L 1269 antibody, light chain 9606
468 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
469 3U0T 1 A, C ponezumab LC Fab 9606
470 5HYS 2 B, D, F, L Uncharacterized protein 9606
471 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
472 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
473 5I15 1 L FAB LIGHT CHAIN 9606
474 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
475 5I1E 1 L FAB LIGHT CHAIN 9606
476 2NYY 2 C CR1 monoclonal antibody light chain 9606
477 2GCY 1 A huC25 fab fragment light chain 10090
478 4JLR 2 B, L Motavizumab Fab light chain 9606
479 2QQK 3 L Antibody Light Chain 9606
480 4J1U 1 A, C, E antibody 93F3 Light chain 10090
481 5N4G 2 L LIGHT CHAIN 9606
482 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
483 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
484 5SX5 1 K, L Panitumumab Fab Light Chain 9606
485 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
486 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
487 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
488 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
489 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
490 5BK2 3 D, L sAB Light Chain 9606
491 1TZH 2 A, L Fab YADS1 Light Chain 10090
492 5O1R 3 L, M Uncharacterized protein 9606
493 6CMI 2 C m102.3 light chain 9606
494 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
495 4JZJ 3 B, L Fab Light Chain 10090
496 5BMF 2 L Fab fragment light chain 9606
497 5BO1 3 L, M Fab light chain 9606
498 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
499 4M6O 1 L CNTO7309 light chain 9606
500 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
501 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
502 5LSP 3 L, T 107_A07 Fab light chain 9606
503 4DVR 2 L Fab 48d Light chain 9606
504 3EYQ 1 C M2J5 Fab 9606
505 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
506 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
507 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
508 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
509 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
510 4XXD 1 A, D Fab Light Chain 9606
511 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
512 6BGT 2 A Herceptin light chain mutant 9606
513 6H06 2 B, D, F, L HUMAN FAB ANTIBODY FRAGMENT OF HCBTAU-22.1 FAB ANTIBODY FRAGMENT 9606
514 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
515 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
516 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
517 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
518 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
519 3DVG 1 A Human IgG1 fab fragment light chain 9606
520 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
521 2AGJ 1 L Yvo Fab, Light Chain 9606
522 4JKP 3 L Light chain of antibody 45-46M2 9606
523 3EYO 1 A, C 8f9 Fab 9606
524 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
525 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
526 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
527 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
528 4DN4 1 L CNTO888 LIGHT CHAIN 9606
529 5TRP 2 L DH272 Fab light chain 9606
530 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
531 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
532 6MHR 2 B, E Urelumab Fab kappa chain 9606
533 2FJG 2 A, L Fab light chain 9606
534 4DKF 3 L, M FAb2 Light Chain 9606
535 5TLK 1 A, E M2177 LIGHT CHAIN 10090
536 5TLK 3 C, G H2191 LIGHT CHAIN 10090
537 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
538 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
539 6MEJ 5 L antibody HEPC3 Light Chain 9606
540 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
541 3EFD 1 L FabL 10090
542 4LF3 1 A, D Fab heavy chain 10090
543 5K59 4 F, L Fab light chain 9606
544 6MUB 1 K, L Fab 2G12, light chain 9606
545 6BFQ 2 B, D, F, L Fab Light Chain 9606
546 5WI9 2 E, L 39F7 Fab light chain 9606
547 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
548 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
549 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
550 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
551 4LEO 2 B RG7116 Fab light chain 10090
552 4G7Y 2 L Fragment antibody light chain 9606
553 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
554 4PY8 4 J antibody 3.1 light chain Fab 9606
555 3SDY 4 L Antibody CR8020, Light Chain 9606
556 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
557 3IXT 1 B, L Motavizumab Fab light chain 10090
558 6FAX 1 L Lob 7.4 light chain 9606
559 4NP4 3 L, M bezlotoxumab light chain 9606
560 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
561 4XCE 1 B, D, L 4E10 Fab light chain 9606
562 5I1I 1 L FAB LIGHT CHAIN 9606
563 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
564 4ERS 1 L Fab light chain 9606
565 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
566 4MWF 2 B, L Fab AR3C light chain 9606
567 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
568 3SQO 3 L J16 Light chain 9606
569 4K3J 4 L Onartuzumab Fab light chain 10090
570 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
571 4PS4 1 L M1295 LIGHT CHAIN 9606
572 5GGT 3 L IGK@ protein 9606
573 6MNF 1 K, L Fab 2G12, light chain 9606
574 3HI1 2 A, L F105 Light Chain 9606
575 4PY7 2 B, J antibody 3.1 light chain Fab 9606
576 6AL5 2 L B43 LIGHT CHAIN 9606
577 4K8R 3 C Fab1, light chain 9606
578 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
579 5VOB 7 L Fab 8I21 light chain 9606
580 6CMG 2 B m102.3 light chain 9606
581 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
582 6ML8 4 L C05 antibody Fab light chain 9606
583 1TZI 1 A Fab YADS2 Light Chain 10090
584 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
585 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
586 4X7T 2 B, L Omalizumab-Fab Light chain 9606
587 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
588 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
589 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
590 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
591 5XMH 2 C, L YES8c light chain 9606
592 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
593 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
594 6MEI 3 L antibody HEPC3 Light Chain 9606
595 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
596 5I1G 1 L FAB LIGHT CHAIN 9606
597 2QQL 3 L Antibody Light Chain 9606
598 4XCC 1 L 4E10 Fab light chain 9606
599 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
600 5SX4 1 I, L Panitumumab Fab Light Chain 9606
601 3WD5 2 L Adalimumab Light Chain 9606
602 4NHC 1 L FAB LIGHT CHAIN 9606
603 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
604 5GZO 3 D, L Antibody light chain 9606
605 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
606 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
607 5GMQ 3 C MCA1 light chain 9606
608 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
609 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
610 4HFU 4 L Fab 8M2 light chain 9606
611 5TRU 1 L, l Ipilimumab Fab light chain 9606
612 4FP8 3 L, M, N, O Antibody C05, light chain 9606
613 4YPG 1 A, L Sifalimumab light chain 9606
614 6CW2 4 B antibody light chain 9606
615 3BE1 3 L Fab Fragment-Light Chain 9606
616 2FJH 2 A, L Fab fragment light chain 9606
617 5XEZ 3 D, L Antibody, mAb1, light chain 9606
618 4K9E 1 L light chain 10090
619 6MEF 2 L antibody AR3C Light Chain 9606
620 3P0V 1 L, M Fab DL11 light chain 9606
621 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
622 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
623 5VIG 2 B, L Fab light chain 9606
624 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
625 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
626 4KVN 3 L Human IgG Light Chain 9606
627 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
628 5VYF 1 A, L Antibody light chain 10090
629 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
630 5WUX 2 B, D, L light 9606
631 3OB0 1 K, L Fab 2G12, light chain Fab 9606
632 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
633 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
634 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
635 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
636 5DUM 2 L 65C6 Light Chain 9606
637 4I18 1 B, L antibody light chain Fab 10090
638 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
639 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
640 3IDY 3 C, L Fab b13 light chain 9606
641 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
642 3IVK 1 B, L Fab light chain man 10090
643 3KYK 2 L Light Chain Li33 IgG1 9606
644 5TGB 2 B, L 02-CB Fab Light Chain 9606
645 5I19 1 L FAB LIGHT CHAIN 9606
646 5TH9 1 L, M, N GS-5745 Fab light chain 9986
647 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
648 4IRZ 2 L Fab Natalizumab light chain 9606
649 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
650 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
651 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
652 5FEC 2 B, L germline 3BNC60 light chain 9606
653 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
654 2R56 2 L, M IgE Fab Fragment, light chain 9606
655 1ZA6 1 A, C, E, G IGG Light chain 9606
656 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
657 6FGB 3 L 1519.g57- Light chain 9606
658 4ZS6 1 D, L fab Light Chain 9606
659 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
660 6APB 3 L ADI-14359 Fab Light Chain 9606
661 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
662 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
663 5K9K 2 B, L 56.a.09 Light chain 9606
664 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
665 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
666 5W4L 6 C, E Antibody N12-i3 light chain 9606
667 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
668 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
669 5CZV 3 L Fab 20350 light chain 9606
670 5XF1 3 D, L Antibody mAb1 Light chain 9606
671 4P59 3 L MOR09825 Fab fragment light chain 9606
672 5XXY 2 L light chain of atezolizumab fab 9606
673 5CJO 3 L FAB light chain 10090
674 4LMQ 3 I, L Stromal cell-derived factor 1 9606
675 3N85 2 L Fab37 Light Chain 9606
676 6AMM 1 L CAT192 Fab Light chain 9606
677 3G6J 3 E, G Fab light chain 9606
678 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
679 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
680 6B9J 3 B, L Fab vv138 Light chain 9606
681 5O4G 2 A MF3958 FAB light chain 9606
682 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
683 4DKE 3 L, M FAb1.1 Light Chain 9606
684 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
685 5I17 1 A, L FAB LIGHT CHAIN 9606
686 5VIC 2 L Fab light chain 9606
687 6MEK 3 D, L HEPC3 Light Chain 9606
688 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
689 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
690 4R8W 4 L Light chain of neutralizing antibody CT149 9606
691 5TPN 3 L hRSV0 light chain 9606
692 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
693 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
694 4NRY 1 B, L m66 Heavy Chain 9606
695 6N2X 1 K, L Fab 2G12 light chain 9606
696 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
697 3S37 1 L 1121B Fab light chain 10090
698 5TZT 1 B, L Light Chain of Fab C47B161 9606
699 5XHF 1 A, C polypeptide (L chain) 10090
700 5VL7 4 L Fab33 light chain 9606
701 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
702 5JXE 2 C, F Pembrolizumab Fab light chain 9606
703 5KZC 3 D, G, L VRC01 Fab light chain 9606
704 5W42 4 L Fab H3v-47 light chain 9606
705 4JM2 3 C 17b Light chain Fab 9606
706 6DEZ 1 A, L Anti-phosphotyrosine antibody PY20-4D5 light chain 32630
707 1S78 2 C, E Pertuzumab Fab light chain 10090
708 5BK0 1 A, C 663 Antibody, light chain 9606
709 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
710 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
711 5D1Z 1 A, H Y10 Light Chain 9606
712 5D1Z 3 C, E D4-10 Light Chain 9606
713 5GGR 2 B, L light chain 9606
714 5IBL 4 D, L 6639 Light Chain 9606
715 4XHJ 3 C, G Fab-RC light chain 9606
716 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
717 5O4O 1 A MF3178 FAB light chain 9606
718 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
719 4N90 3 E, G, I Fab light chain 9606
720 5BK5 2 A, C, E, G 663 germline antibody, light chain 9606
721 5VGJ 3 L VRC38.01 Fab Light Chain 9606
722 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
723 6B0E 1 A 1260 antibody, light chain 9606
724 5D1Q 1 A D2-06 Light Chain 9606
725 5D1Q 4 D P5 Light Chain 9606
726 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
727 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
728 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
729 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
730 5XHV 3 L, Q S40 light chain 9606
731 5UWE 2 L HUMAN ANTI-HIV ANTIBODY N12-I2 Fab LIGHT CHAIN 9606
732 4IOF 3 D, F Fab-bound IDE, light chain 10090
733 5FUO 3 L FAB LIGHT CHAIN 9606
734 5FEH 1 A, C, E PCT64_26 Fab light chain 9606
735 4JHW 2 L D25 light chain 9606
736 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
737 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
738 4M1C 3 D, F Fab-bound IDE, light chain 9606
739 5UQY 3 C, G, K, O MR78 Fab light chain 9606
740 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
741 3ULV 2 L Fab15 light chain 9606
742 5UG0 3 C 2897 light chain 9606
743 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
744 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
745 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
746 5UOE 3 L, N, Q, T, W FAB light chain 9606
747 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
748 5D1X 1 A D4-30 Light Chain 9606
749 5D1X 4 D P5 Light Chain 9606
750 5JW3 4 L MEDI8852 light chain 9606
751 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
752 5UMI 2 B, L PA50 Fab Light chain 9606
753 6D11 2 B, D 1450 Antibody, Light chain 9606
754 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
755 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
756 3S36 1 L 1121B light chain 10090
757 5CWS 1 A, G sAB-158 Fab Light Chain 9606
758 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
759 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
760 2R0K 2 L antibody light chain of Fab58 9606
761 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
762 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
763 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
764 4G80 3 B, D, F, H fragment antibody light chain 9606
765 3JWO 3 L FAB 48D LIGHT CHAIN 9606
766 5CD5 3 D DRVIA7 Fab Light Chain 9606
767 3P11 2 L Fab DL11 light chain 9606
768 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
769 3F12 1 A, C M2J1 Fab 9606
770 3B2V 1 L IMC-11F8 FAB Light chain 9606
771 5IGX 3 L germline NIH45-46 light chain 9606
772 3ULU 2 L Fab15 light chain 9606
773 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
774 6ATT 3 L Antibody 39S Fab light chain Antibody, light chain 9606
775 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
776 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
777 4XI5 3 C Fab-94 light chain 9606
778 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
779 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
780 6EAY 1 L CA45 light chain 9541
781 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
782 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
783 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
784 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
785 5K9O 2 B, L 31.b.09 Light Fv 9606
786 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
787 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
788 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
789 5JW4 6 R MEDI8852 light chain 9606
790 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
791 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
792 5VOC 7 L Fab 8I21 light chain 9606
793 5J3D 2 B, D, L 14N4 light chain 9606
794 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
795 5ESZ 2 B, L CH04 Light Chain 9606
796 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
797 3EFF 1 A, C FAB 10090
798 3PJS 1 A, C FAB light chain 10090
799 5O7P 2 A MF3178 FAB light chain 9606
800 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
801 4ZYP 5 E, G, I AM14 antibody light chain 9606
802 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
803 5DWU 4 L Fab - Light Chain 9606
804 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
805 6EA7 4 L, N, R ADI-15878 Fab Light Chain 9606
806 5I8H 5 F, H VRC34.01 Fab light chain 9606
807 4RQS 2 C 17b Fab Light Chain 9606
808 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
809 4R4H 3 L Antibody 2.2c, Light chain 9606
810 6EA5 4 L, N, R ADI-15878 Fab Light Chain 9606
811 5VOD 7 L Fab 9I6 light chain 9606
812 5FHC 5 L Antibody 114 Fab light chain 9606
813 4XMN 6 L Antibody 87 light chain 32630
814 4XMM 8 L Antibody 57 light chain 9606
815 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
816 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
817 6MZJ 2 C, L VRC01GL light chain germline VK3-11 with the mature CDRL3 of VRC01 9606
818 6MYY 2 C, F, L VRC01GL light chain germline VK3-11 with the mature CDR L3 of VRC01 9606
819 6MJZ 3 L PIA174 Fab Light chain 9606
820 6HJP 4 H, J, L Light chain of FISW84 Fab Fragment 9606
821 6HJQ 4 H, J, L Light chain of FISW84 Fab 9606
822 6E1K 2 C, E cat06 light chain 9606
823 6DJP 6 F 68 light chain Fab 10090
824 6CUF 2 4, L, l vFP1.01 Light chain 10090
825 6CMO 5 L Fab light chain 32630
826 6CM3 4 J, L, N 17b Fab light chain 9606
827 6CDE 2 4, L, l vFP20.01 Light chain 9606
828 6CDI 8 4, L, l vFP16.02 Light Chain 9606
829 6BF7 3 D, F Fab H11-E light chain 10090
830 6BF9 3 D, F Fab H11-E light chain 10090
831 6B7Z 3 D, F FAB H11 light chain 10090
832 6B70 3 D, F FAB H11-E light chain 10090
833 5VN3 1 L, N, O 17b Fab light chain 9606
834 5GZR 4 L, N Z23 Fab light chain 9606
835 5THR 4 J, K, L 17b Fab VL domain 9606
836 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
837 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
838 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
839 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
840 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
841 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
842 2ESG 1 L, M Immunoglobulin A1 light chain 9606
843 1R70 1 A, C Human IgA2(m1) Light Chain 9606
844 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606