Sequence Similarity Clusters for the Entities in PDB 1G9N

Entity #1 | Chains: G
ENVELOPE GLYCOPROTEIN GP120 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 9 2837
95 % 6 9 3556
90 % 8 12 2710
70 % 83 126 179
50 % 83 126 218
40 % 83 126 239
30 % 83 129 243
Entity #2 | Chains: C
T-CELL SURFACE GLYCOPROTEIN CD4 protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 21 37 712
95 % 25 42 846
90 % 25 42 881
70 % 25 42 912
50 % 25 42 964
40 % 25 42 984
30 % 25 42 960
Entity #3 | Chains: L
ANTIBODY 17B, LIGHT CHAIN protein, length: 214 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 39036
95 % 19 24 1475
90 % 462 665 3
70 % 1268 1803 2
50 % 3092 4435 1
40 % 3092 4435 1
30 % 3619 5225 1
Entity #4 | Chains: H
ANTIBODY 17B, HEAVY CHAIN protein, length: 229 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 37854
95 % 19 24 1473
90 % 19 24 1500
70 % 1494 2145 1
50 % 3093 4435 1
40 % 3093 4435 1
30 % 3620 5225 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4XCF 1 L 4E10 Fab light chain 9606
3 5X08 2 L Fab 4E10 Light chain 9606
4 4XAW 1 L 4E10 Fab light chain 9606
5 2VXV 2 L HUMAN IGG ABT-325 9606
6 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
7 5I8C 2 B VRC34.01 Fab light chain 9606
8 3PP4 2 L GA101 Fab light chain 10090
9 4PTU 1 A Antibody pn132p2C05, light chain 9606
10 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
11 4XC3 1 L 4E10 Fab light chain 9606
12 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
13 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
14 4NWU 2 L APE1551 Ab Fab light chain 9606
15 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
16 5EWI 2 L VRC38.01 Light Chain 9606
17 5E2W 1 L AT8 LIGHT CHAIN 10090
18 5E2V 1 L AT8 LIGHT CHAIN 10090
19 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
20 3QQ9 1 C, L 101F LIGHT CHAIN 10090
21 5I1K 1 L FAB LIGHT CHAIN 9606
22 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
23 5V7U 1 L CBTAU-22.1 Fab light chain 9606
24 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
25 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
26 3QRG 1 L Fab light chain 9606
27 3NCJ 1 L Fab15 Mut8 light chain 9606
28 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
29 1UM5 1 L Antibody 21H3 L chain 10090
30 4NWT 1 L APE1531 Ab Fab light chain 9606
31 3NA9 1 L Fab15 light chain 9606
32 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
33 4LRI 1 A, B MSL-109 Light Chain 9606
34 4JN2 1 A, L anti dabigatran Fab 10090
35 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
36 4HHA 1 A Fab KE5 Fab fragment KE5 9606
37 3NAA 1 L Fab15 Mut5 light chain 9606
38 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
39 5IK3 2 B, D 1E03 Fab fragment light chain 9606
40 5IT2 2 L light chain 9606
41 4PUB 2 L DX-2930 LIGHT CHAIN 9606
42 3OAZ 2 K, L Fab 2G12, light chain 9606
43 4YGV 2 B, L aDabi-Fab2a light chain 9606
44 3EO0 1 A, C GC-1008 Fab Light Chain 10090
45 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
46 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
47 4JHA 2 L D25 light chain 9606
48 4PTT 1 A Antibody pn132p2C05, light chain 9606
49 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
50 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
51 4DGV 2 L HCV1 Light Chain 9606
52 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
53 3IU4 2 L chP3 Fab light chain 10090
54 3P0Y 3 L Fab DL11 light chain 9606
55 5IBU 1 B, L 6652 Light Chain 9606
56 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
57 3NAC 1 L Fab15 Mut7 light chain 9606
58 4YHO 2 L aDabi-Fab3 light chain 9606
59 4DGY 2 L HCV1 Light Chain 9606
60 3MXW 2 L 5E1 light chain 9606
61 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
62 3EO9 1 L Efalizumab Fab fragment, light chain 9606
63 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
64 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
65 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
66 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
67 2FX7 1 L Fab 4E10 Light Chain 9606
68 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
69 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
70 5I18 1 L FAB LIGHT CHAIN 9606
71 4JN1 2 L anti-dabigatran Fab1, light chain 10090
72 3SOB 1 L antibody light chain 9606
73 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
74 5DR5 2 L AbD09097 Fab light chain 9606
75 4KQ3 1 L CNTO3186 light chain Fab 9606
76 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
77 4I77 2 L Lebrikizumab light chain Fab 9606
78 4HJG 1 A Trastuzumab light chain 9606
79 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
80 3FN0 1 L Fab Z13e1 light chain 9606
81 4YHI 2 B, L aDabi-Fab2a light chain 9606
82 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
83 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
84 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
85 4MAU 1 L C2244 light chain SEE REMARK 999 10090
86 1OP3 1 K, L FAB 2G12, light chain light chain 9606
87 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
88 4LKX 2 B Fab fragment light chain 9606
89 5JW5 2 B, L MEDI8852 Light chain 9606
90 3QWO 1 B, L motavizumab light chain 10090
91 4IOI 1 A Trastuzumab light chain 9606
92 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
93 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
94 5I16 1 A, L FAB LIGHT CHAIN 9606
95 5F9O 3 L CH235.09 Light chain 9606
96 1UM4 1 L Antibody 21H3 L chain 10090
97 4RBP 1 K, L Fab 2G12 light chain 9606
98 4XVS 2 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 Light chain 9606
99 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
100 1NGX 1 A, L Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
101 5GGQ 1 L nivolumab light chain 9606
102 3OAY 1 K, L Fab 2G12, light chain 9606
103 5K9J 2 L 56.a.09 light chain 9606
104 5TF1 2 L O2-CC Fab Light Chain 9606
105 3TCL 2 B, L CH04 Light Chain Fab 9606
106 4OJF 2 L Humanised 3D6 Fab Light Chain 10090
107 5F7E 2 L Fab light chain 9606
108 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
109 5FHA 2 L Antibody 114 Fab light chain 9606
110 5UMN 3 D, F Antibody C05, light chain 9606
111 4X7S 2 L Ig kappa chain C region residues 23-236 9606
112 1UM6 1 L antibody 21h3, L chain 10090
113 4X0K 2 B, L Fab fragment light chain 9606
114 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
115 5E8E 1 A IGA FAB LIGHT CHAIN 9606
116 2HFF 1 A, L CB2 Fab, light chain 9606
117 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
118 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
119 5GGS 2 B, D light chain 9606
120 5I1L 1 A, L FAB LIGHT CHAIN 9606
121 5GGV 1 L light chain 9606
122 3L5X 1 L H2L6 LIGHT CHAIN 9606
123 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
124 2R8S 2 L Fab light chain 10090
125 4HKZ 1 A Trastuzumab light chain 9606
126 5CHN 2 B, L Antibody 5M16 Fab Light Chain 9606
127 3SO3 2 B A11 FAB light chain 9606
128 3IDG 1 A 2F5 Fab light chain 9606
129 3OAU 2 L Fab 2G12, light chain 9606
130 4WY7 2 L Fab 4E10Light chain 9606
131 4ZYK 2 B, L AM14 light chain 9606
132 5E94 1 A, C Antibody Fab fragment light chain 10090
133 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
134 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
135 2O5X 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
136 4HIE 1 A Fab 023.102 9606
137 4LEX 1 L FAB HEAVY CHAIN 10090
138 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
139 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
140 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
141 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
142 4KMT 1 L light chain O12/KAPPA Fab 9606
143 3NZH 1 L 5F6 LIGHT CHAIN 10090
144 1RHH 1 A, C Fab X5, light chain 9606
145 1TJG 1 L FAB 2F5 Light Chain 9606
146 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
147 4XTR 3 D, F Antibody Light chain 32630
148 1RZ7 1 L Fab 48d light chain 9606
149 1RZG 2 B, D Fab 412d heavy chain 9606
150 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
151 3PGF 3 L SAB Light Chain 9606
152 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
153 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
154 4YHL 2 L aDabi-Fab2b light chain 9606
155 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
156 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
157 2QQN 3 L Antibody light chain 9606
158 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
159 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
160 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
161 4YHM 2 L aDabi-Fab2b light chain 9606
162 1C5B 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
163 3X3F 2 L Light chain of KMTR2 9606
164 2CMR 3 L D5 9606
165 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
166 5CZX 3 D, L 20358 Fab light chain 9606
167 3GRW 2 L Fab light chain 9606
168 5I1D 1 A, L FAB LIGHT CHAIN 9606
169 3QCU 2 L, M LT3015 antibody Fab fragment, light chain 9606
170 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
171 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
172 5DRX 2 B, L CLL240 BCR light chain 9606
173 4HIX 2 L Humanized 3D6 Fab light chain 10090
174 4LKC 1 A Fab fragment of PCSK9 antibody 9606
175 4OM1 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
176 4KZD 2 L BL3-6 Fab antibody, light chain 10090
177 4HCR 2 L, N PF-547659 light chain 9606
178 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
179 1TJH 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
180 4HIH 1 A, C Fab 023.102 9606
181 4YHK 2 L aDabi-Fab2a light chain 9606
182 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
183 3DRQ 1 A 2F5 Fab' light chain 9606
184 5IES 2 L VRC01cHuGL2 Fab light chain 9606
185 4UV7 3 L GC1118A 9606
186 1TJI 1 L anti-HIV-1 antibody 2F5 Light Chain 9606
187 3QNX 1 A Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
188 4OLZ 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
189 3D0V 1 A 2F5 Fab heavy chain 9606
190 3S34 1 L 1121B Fab light chain 10090
191 1GAF 1 L CHIMERIC 48G7 FAB BOTH FAB CHAINS ARE DERIVED FROM THE MATURE (HYBRIDOMA LINE) ANTIBODY. THE LIGHT CHAIN CONSISTS OF THE VJ VARIABLE DOMAIN FROM MOUSE AND THE C(KAPPA) CONSTANT REGION FROM HUMAN. THE HEAVY CHAIN CONSISTS OF THE VDJ VARIABLE DOMAIN FROM MOUSE AND THE C(H1) CONSTANT REGION FROM HUMAN VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
192 3MOD 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
193 5E2T 1 L AT8 LIGHT CHAIN 10090
194 2F5B 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
195 1U8I 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
196 2RCS 1 L IMMUNOGLOBULIN 48G7 GERMLINE FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
197 2AJ3 1 A, C, E Fab m18, Light Chain 9606
198 3IDI 1 A 2F5 Fab light chain 9606
199 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
200 3QO0 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
201 4NRX 3 B, E, L m66 Light Chain 9606
202 3O2D 1 L ibalizumab light chain 10090
203 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
204 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
205 5V7R 1 L CBTAU-7.1 Fab light chain 9606
206 1AJ7 1 L IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN) VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 10090
207 2R0L 1 L antibody light chain 32630
208 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
209 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
210 3QNZ 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
211 3Q1S 1 L Z13e1 Fab light chain 9606
212 1U8H 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
213 3FO2 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
214 5F96 3 L LIGHT CHAIN OF ANTIBODY CH235.12 9606
215 2F5A 1 L PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN)) FAB' 9606
216 4OLU 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
217 3KR3 3 L antibody-Fab (light chain) 9606
218 5DK3 1 A, F Light Chain 9606
219 4OLX 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
220 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
221 4YHN 2 B, L aDabi-Fab3 light chain 9606
222 5GGU 2 B, L light chain 9606
223 3MOA 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
224 3QO1 1 A Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN 9606
225 2PR4 1 L nmAb 2F5 Fab' Heavy Chain 9606
226 4D9Q 2 D, L Anti-Factor D, light chain 9606
227 1A4J 1 A, L IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN) FAB 10090
228 5KW9 3 L IgA Light chain 9606
229 3QNY 1 A, C FAB FRAGMENT OF IMMUNOGLOBULIN A1 LIGHT CHAIN 9606
230 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
231 5DRW 2 B CLL183 BCR antibody light chain 9606
232 1FL5 1 A, L ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
233 2O5Z 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
234 4OM0 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
235 3AAZ 2 B, L Humanized recombinant Fab fragment of a murine; antibody 9606
236 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
237 3O2V 1 L Chimeric antibody Fab 1E9, light chain 10090
238 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
239 2FX9 1 L, M Fab 4E10 Light Chain 9606
240 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
241 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
242 1TZG 1 L, M Fab 4E10 light chain 9606
243 3W9D 2 B, D Antibody Fab light chain 9606
244 1U95 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
245 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
246 3BN9 2 C, E E2 Fab Light Chain 9606
247 4HWE 2 L Fab light chain light chain 9606
248 1U8K 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
249 5TZ2 2 L C47B222 Fab Light Chain 9606
250 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
251 4OGX 3 L DX-2930 LIGHT CHAIN 9606
252 3W9E 3 B Antibody Fab light chain 9606
253 5TFS 2 L 02-K Fab Light chain 9606
254 3UTZ 1 A, D, E Metalloproteinase, light chain 10090
255 5E2U 1 L AT8 LIGHT CHAIN 10090
256 1OM3 1 L, M FAB 2G12, light chain light chain 9606
257 4KZE 2 L BL3-6 Fab antibody, light chain 10090
258 5WT9 2 L Light Chain of Nivolumab 9606
259 4HIJ 1 A, C Fab 023.102 light chain 9606
260 3FO1 1 A, L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
261 4XVU 3 D, F, J, L Antibody light chain 32630
262 5B71 1 A, C SKY59 Fab light chain 9606
263 3QCT 2 L LT3015 antibody Fab fragment, light chain 9606
264 3EYF 1 A, C 8f9 Fab 9606
265 3NAB 1 L Fab15 Mut6 light chain 9606
266 3IDN 1 A 2F5 Fab light chain 9606
267 5I1C 1 L FAB LIGHT CHAIN 9606
268 1RZ8 1 A, C Fab 17b light chain 9606
269 4WV1 3 A, D Fab light chain 9606
270 5EII 2 B, L Fab Light Chain 9606
271 5KNA 2 L IgG4 Light Chain 9606
272 4OLY 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
273 4FNL 2 L, M Antibody C05, Light Chain 9606
274 4UB0 2 L IgG1, light chain 9606
275 1U92 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
276 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
277 1BJ1 1 J, L FAB FRAGMENT HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
278 1U91 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
279 5I1H 1 L FAB LIGHT CHAIN 9606
280 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
281 1NGY 1 A Mature Metal Chelatase Catalytic Antibody, Light chain Fab fragment 10090
282 5I1J 1 L FAB LIGHT CHAIN 9606
283 3IDX 3 L Fab b13 light chain 9606
284 1U8Q 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
285 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
286 3IDJ 1 A 2F5 Fab light chain 9606
287 3IDM 1 A 2F5 Fab light chain 9606
288 1U8J 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
289 1ZLV 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
290 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
291 4K94 1 L Fab19 heavy chain 9606
292 1ZLS 1 L FAB 2G12, light chain FAB, Light Chain 9606
293 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
294 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
295 3D0L 1 A 2F5 heavy chain 9606
296 5KMV 2 I, L IgG4 light chain 9606
297 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
298 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
299 3FCT 1 A, C PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY) CHIMERIC FAB FRAGMENT FAB FRAGMENT 9606
300 3X3G 2 L Light chain of KMTR2 9606
301 5E08 2 L Fab Light Chain 9606
302 2P8L 1 A nmAb 2F5, light chain 9606
303 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
304 5IBT 2 L UCA Light Chain 9606
305 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
306 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
307 1A4K 1 A, L ANTIBODY FAB FAB 10090
308 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
309 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
310 4NGH 1 L FAB LIGHT CHAIN 9606
311 4EDW 2 L tanezumab Fab light chain 9606
312 1UCB 1 L CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96 MOUSE VH AND VL DOMAINS, HUMAN CL KAPPA AND CH1 IGG1 DOMAINS 9606
313 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
314 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
315 4NM4 1 L, M Antibody CR8043, Light Chain 9606
316 4LST 3 L LIGHT CHAIN OF ANTIBODY VRC01 9606
317 3U7Y 3 L NIH45-46 light chain, Ig kappa chain C region 9606
318 1U8M 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
319 4D9R 2 D, L Fab light chain 9606
320 3U7W 2 L Light chain, Ig kappa chain C region 9606
321 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
322 4G7V 2 L fragment antibody light chain 9606
323 4HFW 1 A, L 6-26 Fab Light chain 9606
324 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
325 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
326 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
327 4S1Q 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
328 4KQ4 1 L CNTO7357 light chain Fab (mouse variable domain, human constant domain) 10090
329 3INU 2 L, N KZ52 antibody fragment light chain 9606
330 5EU7 3 C, D FAB light chain 9606
331 3LEV 2 L 2F5 ANTIBODY LIGHT CHAIN 9606
332 4OLV 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
333 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
334 2EH7 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
335 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
336 4HII 1 A, C Fab 023.102 light chain 9606
337 2EH8 1 L HUMANIZED KR127 FAB, LIGHT CHAIN 10090
338 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
339 4DN3 1 L CNTO888 LIGHT CHAIN 9606
340 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
341 4LSS 3 L LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation 9606
342 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
343 3MOB 2 L ANTI-HIV-1 ANTIBODY 2F5 LIGHT CHAIN 9606
344 3EYV 1 A, L hu3S193 Fab, light chain 10090
345 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
346 1HKL 1 L 48G7 FAB VARIABLE DOMAINS OF LIGHT AND HEAVY CHAINS AND CONSTANT DOMAINS OF LIGHT AND HEAVY CHAINS 9606
347 3PP3 2 K, L GA101 Fab light chain 10090
348 5IJK 3 C, D 1E03 Fab fragment light chain 9606
349 3BDY 2 L Fab Fragment -Light Chain 9606
350 5I8E 2 B, D VRC34.01 Fab light chain 9606
351 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
352 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
353 5UIX 2 L DH576 Fab light chain 9606
354 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
355 1U8N 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
356 4HWB 3 L Fab light chain 9606
357 1U93 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
358 3O2W 1 L Chimeric antibody Fab 1E9, light chain 10090
359 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
360 2HFG 1 L CB3s Fab light chain (kappa) 9606
361 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
362 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
363 4JQI 3 L Fab30 light chain 10090
364 3SKJ 1 L, M Antibody, light chain 9606
365 3U30 2 B, E Light chain Fab 9606
366 3QCV 2 L, M LT3015 antibody Fab fragment, light chain 9606
367 3U0T 1 A, C ponezumab LC Fab 9606
368 5HYS 2 B, D, F, L Uncharacterized protein 9606
369 3FO0 1 L Catalytic antibody Fab 13G5 kappa light chain chimera FUSION PROTEIN. THE VARIABLE DOMAIN (RESIDUES 1-107) IS FROM A MURINE SOURCE AND THE CONSTANT DOMAIN (RESIDUES 108-214) IS FROM A HUMAN SOURCE 10090
370 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
371 5I15 1 L FAB LIGHT CHAIN 9606
372 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
373 5I1E 1 L FAB LIGHT CHAIN 9606
374 2NYY 2 C CR1 monoclonal antibody light chain 9606
375 2GCY 1 A huC25 fab fragment light chain 10090
376 4JLR 2 B, L Motavizumab Fab light chain 9606
377 2QQK 3 L Antibody Light Chain 9606
378 4J1U 1 A, C, E antibody 93F3 Light chain 10090
379 2PW2 1 A 2F5 Fab' heavy chain 9606
380 3NGB 3 C, F, K, L Antigen binding fragment of light chain: Antibody VRC01 9606
381 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
382 5SX5 1 K, L Panitumumab Fab Light Chain 9606
383 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
384 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
385 2PW1 1 A 2F5 Fab fragment heavy chain 9606
386 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
387 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
388 1TZH 2 A, L Fab YADS1 Light Chain 10090
389 4XML 1 L Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
390 4JZJ 3 B, L Fab Light Chain 10090
391 5BMF 2 L Fab fragment light chain 9606
392 5BO1 3 L, M Fab light chain 9606
393 4M6O 1 L CNTO7309 light chain 9606
394 3QEH 2 B, D, F, H Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain Fab light chain 9606
395 4OLW 3 L Antigen binding fragment of light chain: Antibody VRC01 9606
396 4DVR 2 L Fab 48d Light chain 9606
397 3EYQ 1 C M2J5 Fab 9606
398 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
399 2O5Y 1 L chimeric antibody Fab 1E9-DB3 light chain 10090
400 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
401 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
402 4XXD 1 A, D Fab Light Chain 9606
403 5F9W 3 C, L Light chain of CH235-lineage antibody CH235 9606
404 1CLY 1 L IGG FAB (HUMAN IGG1, KAPPA) COMPLEXED WITH LEWIS Y NONOATE METHYL ESTER CHIMERIC FRAGMENT (BR96) 9606
405 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
406 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
407 1U8L 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
408 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
409 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
410 3DVG 1 A Human IgG1 fab fragment light chain 9606
411 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
412 2AGJ 1 L Yvo Fab, Light Chain 9606
413 4JKP 3 L Light chain of antibody 45-46M2 9606
414 3EYO 1 A, C 8f9 Fab 9606
415 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
416 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
417 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
418 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
419 4DN4 1 L CNTO888 LIGHT CHAIN 9606
420 5TRP 2 L DH272 Fab light chain 9606
421 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
422 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
423 2FJG 2 A, L Fab light chain 9606
424 4DKF 3 L, M FAb2 Light Chain 9606
425 5TLK 1 A, E M2177 LIGHT CHAIN 10090
426 5TLK 3 C, G H2191 LIGHT CHAIN 10090
427 1UWE 2 L, U, X ANTIBODY 14D9 FAB LIGHT CHAIN, RESIDUES 1-212 10090
428 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
429 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
430 3EFD 1 L FabL 10090
431 4LF3 1 A, D Fab heavy chain 10090
432 5K59 4 F, L Fab light chain 9606
433 1UWG 2 L, X ANTIBODY 14D9 CATALYTIC ANTIBODY 19C9 FAB LIGHT CHAIN, RESIDUES 1-213 10090
434 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
435 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
436 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
437 4LEO 2 B RG7116 Fab light chain 10090
438 4G7Y 2 L Fragment antibody light chain 9606
439 4PY8 4 J antibody 3.1 light chain Fab 9606
440 3SDY 4 L Antibody CR8020, Light Chain 9606
441 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
442 3IXT 1 B, L Motavizumab Fab light chain 10090
443 2P8M 1 A nmAb 2F5, light chain 9606
444 4NP4 3 L, M bezlotoxumab light chain 9606
445 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
446 4XCE 1 B, D, L 4E10 Fab light chain 9606
447 5I1I 1 L FAB LIGHT CHAIN 9606
448 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
449 4ERS 1 L Fab light chain 9606
450 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
451 4MWF 2 B, L Fab AR3C light chain 9606
452 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
453 3SQO 3 L J16 Light chain 9606
454 4K3J 4 L Onartuzumab Fab light chain 10090
455 4PS4 1 L M1295 LIGHT CHAIN 9606
456 5GGT 3 L IGK@ protein 9606
457 3HI1 2 A, L F105 Light Chain 9606
458 4PY7 2 B, J antibody 3.1 light chain Fab 9606
459 4K8R 3 C Fab1, light chain 9606
460 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
461 1ZLU 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
462 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
463 1TZI 1 A Fab YADS2 Light Chain 10090
464 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
465 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
466 4X7T 2 B, L Omalizumab-Fab Light chain 9606
467 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
468 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
469 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
470 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
471 1FL6 1 A, L ANTIBODY GERMLINE PRECURSOR TO 28B4 LIGHT CHAIN (CHAINS L AND A) 10090
472 5U3J 2 L DH511.1 Light Chain Fragment of antigen binding 9606
473 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
474 5I1G 1 L FAB LIGHT CHAIN 9606
475 2QQL 3 L Antibody Light Chain 9606
476 2P8P 1 A nmAb 2F5, light chain 9606
477 4XCC 1 L 4E10 Fab light chain 9606
478 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
479 5SX4 1 I, L Panitumumab Fab Light Chain 9606
480 3WD5 2 L Adalimumab Light Chain 9606
481 4NHC 1 L FAB LIGHT CHAIN 9606
482 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
483 5GZO 3 D, L Antibody light chain 9606
484 2HH0 1 L Light Chain, P-Clone Fab, Chimera 2-109 (mouse), 110-271 (human) 10090
485 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
486 3U46 2 B, L CH02 Light chain Fab 9606
487 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
488 1ZLW 1 K, L FAB 2G12, light chain FAB, Light Chain 9606
489 4HFU 4 L Fab 8M2 light chain 9606
490 5TRU 1 L, l Ipilimumab Fab light chain 9606
491 4FP8 3 L, M, N, O Antibody C05, light chain 9606
492 4YPG 1 A, L Sifalimumab light chain 9606
493 3BE1 3 L Fab Fragment-Light Chain 9606
494 2FJH 2 A, L Fab fragment light chain 9606
495 5XEZ 3 D, L Antibody, mAb1, light chain 9606
496 4K9E 1 L light chain 10090
497 3U4B 2 L CH02 Light chain 9606
498 3P0V 1 L, M Fab DL11 light chain 9606
499 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
500 4FZ8 2 L FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11 9606
501 1U8O 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
502 5VIG 2 B, L Fab light chain 9606
503 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
504 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
505 4KVN 3 L Human IgG Light Chain 9606
506 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
507 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
508 3OB0 1 K, L Fab 2G12, light chain Fab 9606
509 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
510 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
511 5DUM 2 L 65C6 Light Chain 9606
512 4I18 1 B, L antibody light chain Fab 10090
513 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
514 3IDY 3 C, L Fab b13 light chain 9606
515 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
516 3IVK 1 B, L Fab light chain man 10090
517 3KYK 2 L Light Chain Li33 IgG1 9606
518 5TGB 2 B, L 02-CB Fab Light Chain 9606
519 5I19 1 L FAB LIGHT CHAIN 9606
520 5TH9 1 L, M, N GS-5745 Fab light chain 9986
521 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
522 4IRZ 2 L Fab Natalizumab light chain 9606
523 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
524 5FEC 2 B, L germline 3BNC60 light chain 9606
525 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
526 5ESV 2 B, D, L CH03 Light Chain 9606
527 2R56 2 L, M IgE Fab Fragment, light chain 9606
528 1ZA6 1 A, C, E, G IGG Light chain 9606
529 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
530 4ZS6 1 D, L fab Light Chain 9606
531 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
532 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
533 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
534 5K9K 2 B, L 56.a.09 Light chain 9606
535 1NGW 1 A, L Mature Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
536 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
537 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
538 5CZV 3 L Fab 20350 light chain 9606
539 5XF1 3 D, L Antibody mAb1 Light chain 9606
540 4P59 3 L MOR09825 Fab fragment light chain 9606
541 5CJO 3 L FAB light chain 10090
542 4LMQ 3 I, L Stromal cell-derived factor 1 9606
543 3N85 2 L Fab37 Light Chain 9606
544 3G6J 3 E, G Fab light chain 9606
545 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
546 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
547 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
548 4DKE 3 L, M FAb1.1 Light Chain 9606
549 5A3I 4 D, H ANTI-HAEMAGGLUTININ HA1 FAB LIGHT CHAIN 9606
550 3DRT 1 A 2F5 Fab' light chain 9606
551 5I17 1 A, L FAB LIGHT CHAIN 9606
552 1U8P 1 A ANTIBODY 2F5 (LIGHT CHAIN) 9606
553 5VIC 2 L Fab light chain 9606
554 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
555 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
556 4R8W 4 L Light chain of neutralizing antibody CT149 9606
557 5TPN 3 L hRSV0 light chain 9606
558 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
559 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
560 4NRY 1 B, L m66 Heavy Chain 9606
561 4XMK 1 L, M, N Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424 9606
562 3S37 1 L 1121B Fab light chain 10090
563 5TZT 1 B, L Light Chain of Fab C47B161 9606
564 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
565 5JXE 2 C, F Pembrolizumab Fab light chain 9606
566 5KZC 3 D, G, L VRC01 Fab light chain 9606
567 4JM2 3 C 17b Light chain Fab 9606
568 1S78 2 C, E Pertuzumab Fab light chain 10090
569 1OP5 1 K, L FAB 2G12, light chain light chain 9606
570 4UV4 2 L FPRO0165 FAB LIGHT CHAIN 9606
571 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
572 5D1Z 1 A, H Y10 Light Chain 9606
573 5D1Z 3 C, E D4-10 Light Chain 9606
574 5GGR 2 B, L light chain 9606
575 5IBL 4 D, L 6639 Light Chain 9606
576 4XHJ 3 C, G Fab-RC light chain 9606
577 4JDT 3 L Fab light chain NIH45-46 LIGHT CHAIN 9606
578 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
579 4N90 3 E, G, I Fab light chain 9606
580 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
581 5D1Q 1 A D2-06 Light Chain 9606
582 5D1Q 4 D P5 Light Chain 9606
583 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
584 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
585 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
586 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
587 4IOF 3 D, F Fab-bound IDE, light chain 10090
588 5FUO 3 L FAB LIGHT CHAIN 9606
589 4JHW 2 L D25 light chain 9606
590 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
591 3BQU 1 A 2F5 Fab' light chain 9606
592 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
593 4M1C 3 D, F Fab-bound IDE, light chain 9606
594 5UQY 3 C, G, K, O MR78 Fab light chain 9606
595 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
596 3ULV 2 L Fab15 light chain 9606
597 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
598 4S1R 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
599 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
600 3EGS 1 A 2F5 Fab' light chain 9606
601 5D1X 1 A D4-30 Light Chain 9606
602 5D1X 4 D P5 Light Chain 9606
603 5JW3 4 L MEDI8852 light chain 9606
604 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
605 3S36 1 L 1121B light chain 10090
606 3DRO 1 A 2F5 Fab light chain 9606
607 5CWS 1 A, G sAB-158 Fab Light Chain 9606
608 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
609 4S1S 3 L Fab of VRC01 light chain Fab of VRC01 light chain 9606
610 2R0K 2 L antibody light chain of Fab58 9606
611 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
612 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
613 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
614 4G80 3 B, D, F, H fragment antibody light chain 9606
615 3JWO 3 L FAB 48D LIGHT CHAIN 9606
616 5CD5 3 D DRVIA7 Fab Light Chain 9606
617 3P11 2 L Fab DL11 light chain 9606
618 3F12 1 A, C M2J1 Fab 9606
619 3B2V 1 L IMC-11F8 FAB Light chain 9606
620 5IGX 3 L germline NIH45-46 light chain 9606
621 3ULU 2 L Fab15 light chain 9606
622 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
623 4XI5 3 C Fab-94 light chain 9606
624 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
625 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
626 4Q5Z 3 J, L, N, P, R, T, V, X IDE-bound Fab, light chain 10090
627 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
628 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
629 5K9O 2 B, L 31.b.09 Light Fv 9606
630 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
631 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
632 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
633 5JW4 6 R MEDI8852 light chain 9606
634 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
635 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
636 5J3D 2 B, D, L 14N4 light chain 9606
637 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
638 5ESZ 2 B, L CH04 Light Chain 9606
639 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
640 3EFF 1 A, C FAB 10090
641 3PJS 1 A, C FAB light chain 10090
642 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
643 4ZYP 5 E, G, I AM14 antibody light chain 9606
644 5DWU 4 L Fab - Light Chain 9606
645 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9605
646 5I8H 5 F, H VRC34.01 Fab light chain 9606
647 4RQS 2 C 17b Fab Light Chain 9606
648 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
649 4R4H 3 L Antibody 2.2c, Light chain 9606
650 5FHC 5 L Antibody 114 Fab light chain 9606
651 4XMN 6 L Antibody 87 light chain 32630
652 4XMM 8 L Antibody 57 light chain 9606
653 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
654 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
655 5GZR 4 L, N Z23 Fab light chain 9606
656 5THR 4 J, K, L 17b Fab VL domain 9606
657 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
658 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
659 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
660 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
661 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
662 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
663 2ESG 1 L, M Immunoglobulin A1 light chain 9606
664 1R70 1 A, C Human IgA2(m1) Light Chain 9606
665 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606