Sequence Similarity Clusters for the Entities in PDB 1FYT

Entity #1 | Chains: A
HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 65 91 217
95 % 71 98 258 Flexibility: Low
Max RMSD: 1.7, Avg RMSD: 0.6
PDBFlex
90 % 78 114 222
70 % 78 114 242
50 % 109 170 175
40 % 109 170 188
30 % 224 353 79
Entity #2 | Chains: B
HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR-1 BETA CHAIN protein, length: 192 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 30 40 613
95 % 32 43 685 Flexibility: Low
Max RMSD: 2.6, Avg RMSD: 1.0
PDBFlex
90 % 70 94 286
70 % 110 169 151
50 % 110 171 174
40 % 110 171 187
30 % 225 353 79
Entity #3 | Chains: C
HEMAGGLUTININ HA1 PEPTIDE CHAIN protein, length: 13 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #4 | Chains: D
T-CELL RECEPTOR ALPHA CHAIN protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 38818
95 % 19 20 3080 Flexibility: Low
Max RMSD: 0.9, Avg RMSD: 0.7
PDBFlex
90 % 19 20 3154
70 % 185 340 28
50 % 185 341 77
40 % 185 341 99
30 % 4399 7240 1
Entity #5 | Chains: E
T-CELL RECEPTOR BETA CHAIN protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 46300
95 % 7 8 9676 Flexibility: Low
Max RMSD: 0.7, Avg RMSD: 0.5
PDBFlex
90 % 11 14 4228
70 % 193 350 25
50 % 193 353 67
40 % 193 353 87
30 % 4400 7240 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
2 6FR4 1 A TCR 003 alpha chain 9606
3 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
4 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
5 6FR3 1 A 003 TCR Alpha Chain 9606
6 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
7 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
8 2NW2 1 A ELS4 TCR alpha chain 9606
9 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
10 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
11 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
12 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
13 1KGC 1 D T-cell receptor alpha chain 9606
14 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
15 6FUQ 1 A Human F11 T-Cell Receptor 9606
16 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
17 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
18 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
19 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
20 5TEZ 4 I TCR F50 alpha chain 9606
21 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
22 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
23 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
24 6CPH 1 D TCR alpha chain 9606
25 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
26 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
27 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
28 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
29 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
30 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
31 5D7K 1 D MAV36 TCR Alpha Chain 9606
32 3VXS 3 D H27-14 TCR alpha chain 9606
33 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
34 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
35 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
36 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
37 4PJE 3 E, G TCR-alpha 9606
38 4MS8 1 C 42F3 alpha 10090
39 4G9F 4 D beta chain C12C TCR 9606
40 4PJH 3 E, G TCR-alpha 9606
41 5KSA 3 C Bel602 alpha TRAV20*01 9606
42 5D7J 1 A, G M33.64 TCR Alpha Chain 9606
43 4PJ9 3 C TCR-alpha 9606
44 5U16 3 E, G MAIT T-cell receptor alpha chain 9606
45 5D7I 3 E, G M33.64 TCR Alpha Chain 9606
46 4PJ5 3 D, G TCR-alpha 9606
47 5C0C 4 D, I 1E6 TCR Alpha Chain 9606
48 5M01 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
49 4L4T 3 D, G MAIT T-cell receptor alpha chain 9606
50 5EU6 4 D Human TCR Light Chain 9606
51 5M00 3 G Protein Trav14-1,Uncharacterized protein 10090
52 2IAL 1 A, C CD4+ T cell receptor E8 alpha chain 9606
53 2F53 4 D T-cell Receptor, alpha chain 9606
54 5ISZ 4 D TCRalpha chain 9606
55 3QJH 1 A, C 5c.c7 alpha chain 10090
56 5C0B 4 D, I 1E6 TCR Alpha Chain 9606
57 3MFF 1 A, C T cell receptor alpha chain 9606
58 2VLM 1 D JM22 TCR ALPHA CHAIN 9606
59 2BNR 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
60 5IVX 3 E T-CELL RECEPTOR ALPHA CHAIN 10090
61 5NMD 1 A, C human T-cell Receptor alpha chain 9606
62 4NQE 3 D, G TCR alpha 9606
63 6AVF 2 A T-cell receptor alpha variable 4,TCR alpha chain 9606
64 4X6B 1 A, C TCR alpha 9606
65 4ELK 1 A, C Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
66 2P5W 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
67 4ZDH 1 A Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region 9606
68 5U17 2 B, D MAIT T-cell receptor alpha chain 9606
69 5D5M 3 E, G M33.64 TCR Alpha Chain 9606
70 5C07 4 D, I 1E6 TCR Alpha Chain 9606
71 1LP9 4 E, L T-cell Receptor alpha chain 10090
72 4P23 1 A J809.B5 TCR V alpha chain (Va2.8) 10090
73 3VXQ 1 A, D H27-14 TCR alpha chain 9606
74 5U2V 3 E, G MAIT T-cell receptor alpha chain 9606
75 4PJX 3 E, G TCR-alpha 9606
76 3MV7 4 D alpha chain of the TK3 TCR 9606
77 5D2N 1 C, D C25 alpha 9606
78 4G8F 1 A alpha chain clone 42 TCR 9606
79 4NQD 3 D, G TCR alpha chain 9606
80 3QEU 1 A, D DMF5 alpha chain 9606
81 3TJH 3 C 42F3 alpha 10090
82 4GRM 1 A, C A6 alpha chain 9606
83 5WLG 4 D, I T cell receptor alpha variable 8D-2,Human nkt tcr alpha chain chimera 10090
84 4MAY 3 C HY.1B11 TCR alpha chain 9606
85 3QUY 3 C Valpha14 (mouse variable domain, human constant domain) 10090
86 2CDF 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
87 2XNA 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
88 3QH3 1 A, C A6 alpha chain 9606
89 4PJG 3 E, G TCR-alpha 9606
90 5EUO 3 E, G PF6 TCR alpha chain 9606
91 3MV8 4 D alpha chain of the TK3 TCR 9606
92 3RUG 3 E, G Valpha10(mouse variable domain, human constant domain) 10090
93 2PYF 1 A T-Cell Receptor, Alpha Chain 9606
94 3QUZ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
95 4Y19 4 D FS18_alpha 9606
96 2PYE 4 D T-Cell Receptor, Alpha Chain 9606
97 2EYS 1 A NKT15 9606
98 4LCW 3 D, G MAIT T cell receptor alpha chain 9606
99 4G8G 4 D alpha chain C12C TCR 9606
100 4NQC 3 D, G TCR alpha chain 9606
101 4PJC 3 E, G TCR-alpha 9606
102 4JRX 4 D CA5 TCR alpha chain 9606
103 4PJF 3 E, G TCR-alpha 9606
104 4PJ7 3 E, G TCR-alpha 9606
105 5U72 2 B, D MAIT T-cell receptor alpha chain 9606
106 3REV 1 A TCR NB20 ALPHA CHAIN 9606
107 5C08 4 D, I 1E6 TCR Alpha Chain 9606
108 4PRP 4 D TK3 TCR alpha chain 9606
109 2VLJ 4 D JM22 TCR ALPHA CHAIN 9606
110 3QFJ 4 D A6 alpha chain 9606
111 3VXR 3 D H27-14 TCR alpha chain 9606
112 4JFH 1 D alpha24 TCR allele 9606
113 2VLR 4 D, I JM22 TCR ALPHA CHAIN 9606
114 5C0A 4 D, I 1E6 TCR Alpha Chain 9606
115 6FR7 1 A T-Cell Receptor alpha chain 9606
116 5BS0 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
117 4G8E 1 A alpha chain clone 18 TCR 9606
118 2XN9 1 A T CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV27 FUSED TO CONSTANT DOMAIN EXTRACELLULAR DOMAIN, RESIDUES 1-95 9606
119 4PJI 3 E, G TCR-alpha 9606
120 1J8H 4 D T-CELL RECEPTOR ALPHA CHAIN Extracellular Domain 9606
121 4WW2 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
122 3QJF 1 A, C 2B4 alpha chain 10090
123 4WO4 3 C TCR variable DELTA 1 CHAIN and TCR constant Alpha 9606
124 4PRI 4 D TK3 TCR alpha chain 9606
125 5FKA 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS 9606
126 4JFD 4 D High Affinity TCR Alpha Chain 9606
127 4PJA 3 E, G TCR-alpha 9606
128 6BNL 3 C, G NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains 9606
129 6CQN 4 D F5 alpha chain 9606
130 5JHD 4 D, I TCRalpha chain 9606
131 5JZI 4 D, I HCV1406 TCR alpha chain 9606
132 4JFF 4 D High Affinity TCR Alpha Chain 9606
133 5C09 4 D, I 1E6 TCR Alpha Chain 9606
134 6FR8 1 A T-Cell Receptor HA1.7 alpha Chain 9606
135 3W0W 4 D T36-5 TCR alpha chain 9606
136 6CQL 4 D F24 alpha chain 9606
137 2YPL 4 D AGA T-CELL RECEPTOR ALPHA CHAIN 9606
138 4P2O 3 C 2B4 T-cell receptor alpha chain 10090
139 5KS9 3 E, G Bel502 TCR alpha TRAV20*01 9606
140 1TCR 1 A ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) 10090
141 3QDJ 4 D DMF5 alpha chain 9606
142 5WJO 1 A, C PG90 TCR alpha chain 9606
143 4Z7U 3 E, G T-CELL RECEPTOR, S13 ALPHA CHAIN 9606
144 4PJD 3 E, G TCR-alpha 9606
145 6AVG 2 B, C T-cell receptor alpha variable 4,TCR alpha chain 9606
146 2GJ6 4 D A6-Tcr 9606
147 4Z7V 3 E, G T-CELL RECEPTOR, L3-12 ALPHA CHAIN 9606
148 3VXM 4 D C1-28 TCR alpha chain 9606
149 3QI9 3 C NKT TCR V alpha 14 chimera of Mouse variable domain and human constant domain 10090
150 3UTT 4 D, I 1E6 TCR Alpha Chain 9606
151 4PRH 4 D TK3 TCR alpha chain 9606
152 2EYR 1 A NKT12 9606
153 5BRZ 4 D Protein TRAV21,T-cell receptor alpha chain C region 9606
154 4OZF 3 G T-CELL RECEPTOR, JR5.1 ALPHA CHAIN 9606
155 4E41 4 D, I T cell receptor G4 alpha chain 9606
156 4PJB 3 E, G TCR-alpha 9606
157 3HUJ 3 E, G NKT15 T cell receptor alpha-chain 9606
158 5U1R 2 B, D MAIT T-cell receptor alpha chain 9606
159 5HHM 4 D, I JM22 TCR alpha chain 9606
160 2VLK 4 D JM22 TCR ALPHA CHAIN 9606
161 4X6C 3 E, G TCR alpha 9606
162 4EN3 2 A HUMAN NKT TCR ALPHA CHAIN 9606
163 2EYT 1 A, C NKT15 9606
164 1MI5 4 D TcR alpha chain extracellular domain 9606
165 2UWE 4 E, L AHIII TCR ALPHA CHAIN 10090
166 3KPS 4 D LC13 TCR alpha chain 9606
167 4MXQ 1 C 42F3 alpha VmVh chimera 10090
168 4Y16 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
169 6EH8 1 A Human T Cell Receptor Alpha Chain 9606
170 3PWP 4 D A6 TCR alpha chain 9606
171 3VXT 1 A, C T36-5 TCR alpha chain 9606
172 3O4L 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
173 3QEQ 4 D DMF4 alpha chain 9606
174 5XOV 4 G, I V-delta chain of T cell receptor 9606
175 4GKZ 1 A Alpha chain of Class II TCR 9606
176 3O8X 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
177 4E42 1 A, C T cell receptor G4 alpha chain 9606
178 2ESV 4 D KK50.4 T cell receptor alpha chain Extracellular domain 9606
179 6EH9 1 A Human T Cell Receptor Alpha Chain 9606
180 4P46 3 A J809.B5 TCR Y31A alpha chain (Va2.8) 10090
181 4JFE 4 D High Affinity TCR Alpha Chain 9606
182 5NMG 4 D, I Human T-cell receptor alpha chain 9606
183 4IRS 3 C Valpha14 (mouse variable domain, human constant domain) 10090
184 3UTS 4 D, I 1E6 TCR Alpha Chain 9606
185 1FYT 4 D T-CELL RECEPTOR ALPHA CHAIN EXTRACELLULAR DOMAIN 9606
186 6C09 3 C 3C8 T cell receptor alpha-chain 9606
187 5MEN 4 D Protein TRAV22,Human nkt tcr alpha chain 9606
188 3TA3 3 C Valpha14 chimera (mouse variable domain, human constant domain) 10090
189 3KPR 4 D, I LC13 TCR alpha chain 9606
190 2CDG 1 A TCR 5E NON CANONICAL HUMAN NATURAL KILLER (NK) T CELL RECEPTOR 5E NON-VALPHA24 AND VBETA11 9606
191 3RDT 3 A TCR 809.B5 alpha chain 10090
192 1BD2 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 210 9606
193 4L3E 4 D DMF5 alpha chain 9606
194 3PL6 3 C T-cell receptor alpha chain 9606
195 3O9W 3 C Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain) 10090
196 4JRY 4 D SB47 TCR alpha chain 9606
197 5XOT 4 D The Delta chain of TU55 TCR 9606
198 3DX9 1 A, C DM1 T cell receptor alpha chain 9606
199 2JCC 4 E, L TCR ALPHA 10090
200 3UTP 1 D, K 1E6 TCR alpha chain 9606
201 4X6D 3 E, G TCR alpha 9606
202 3D39 4 D A6 TCR alpha chain 9606
203 3ARB 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
204 3QIU 3 C TCR 226 alpha chain 10090
205 4UDU 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
206 4APQ 3 C MOUSE NKT TCR VALPHA14, HUMAN NKT TCR VALPHA14 MOUSE VARIABLE DOMAIN, RESIDUES 1-121, HUMAN CONSTANT DOMAIN, RESIDUES 122-212 10090
207 2AK4 4 D, I, N, T SB27 T cell receptor alpha chain Extracellular Domain 9606
208 3QDG 4 D DMF5 alpha chain 9606
209 4P4K 3 C, G hTCRav22 alpha chain 9606
210 5SWZ 4 D, I, N, S NP1-B17 TCR alpha chain 10090
211 5NMF 4 D HUman T-cell receptor Alpha chain 9606
212 5NMF 6 I HUman T-cell receptor Alpha chain 9606
213 5WKI 3 D T-cell receptor alpha variable 26-1,TRA@ protein 9606
214 4N0C 3 C, G 42F3 VmCh alpha 10090
215 3H9S 4 D A6 TCR alpha chain 9606
216 3QIB 3 C T-cell receptor alpha chain C region 9606
217 6CQQ 4 D, I F24 alpha chain 9606
218 4MNQ 4 D Uncharacterized protein, T-cell receptor, sp3.4 alpha chain 9606
219 4FTV 4 D A6 alpha chain 9606
220 3VWK 3 C NKT15 T cell receptor alpha-chain 9606
221 2IAM 4 C CD4+ T cell receptor E8 alpha chain 9606
222 3C5Z 1 A, E TCR B3K506 Alpha Chain 10090
223 5WKF 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain Chimera 9606
224 3SKN 1 A, C, E, G RL42 T cell receptor, alpha chain 9606
225 2F54 4 D, K T-cell receptor alpha chain 9606
226 4IRJ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
227 4GRL 3 C TCR Hy.1B11 alpha chain 9606
228 3QDM 4 D DMF4 alpha chain 9606
229 1QRN 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
230 5NME 4 D, I T-cell receptor Alpha chain 9606
231 3RGV 1 A Yae62 TCR a chain 10090
232 1AO7 4 D T CELL RECEPTOR ALPHA EXTRACELLULAR DOMAINS V AND C, RESIDUES 1 - 212 9606
233 4PJ8 3 C TCR-alpha 9606
234 3D3V 4 D A6 TCR alpha chain 9606
235 3TYF 1 A, C iNKT Cell Receptor Alpha Chain 562
236 4QRP 4 D, J, K DD31 TCR alpha chain 9606
237 4ZAK 3 C Protein Trav11,Va14Ja18/Vb8.2,Human nkt tcr alpha chain 10090
238 4Y4K 3 C chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain) 10090
239 3ARE 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
240 3FFC 4 D, I CF34 alpha chain 9606
241 3QUX 3 C Valpha14 (mouse variable domain, human constant domain) 10090
242 4IIQ 1 A Human Mucosal Associated Invariant T cell receptor alpha chain 9606
243 5WKH 4 D, I T-cell receptor alpha variable 30,T-cell receptor, sp3.4 alpha chain 9606
244 3MV9 4 D alpha chain of the TK3 TCR 9606
245 2IAN 4 D, I, N, S CD4+ T cell receptor E8 alpha chain 9606
246 4N5E 1 C 42F3 alpha VmCh 10090
247 1MWA 1 A, C 2C T CELL RECEPTOR ALPHA CHAIN 10090
248 5TIL 4 G alpha chain of P14 T cell receptor 10090
249 3HE7 3 C Valpha14(mouse variable domain, human constant domain) 10090
250 3TVM 3 C, G Valpha14 (mouse variable domain, human constant domain) 10090
251 6FR6 1 A Human T-Cell Receptor Alpha Chain 9606
252 4OZH 3 E, G T-cell receptor, s16, alpha chain 9606
253 4OZG 3 E, G T-cell receptor, d2, alpha chain 9606
254 3RTQ 3 C Valpha14 (mouse variable domain, human constant domain) 10090
255 4QOK 4 D Mel5 TCR chain alpha 9606
256 3SCM 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
257 5VCJ 3 C Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) UNP A0A0B4J1J9 residues 22-114,UNP K7N5M3 residues 116-210 10090
258 4WWK 1 A TCR Alpha Chain-TRAV12-3 9606
259 5KSB 3 E, G T15 TCR alpha TRAV20*02 9606
260 4EI5 3 C, G Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
261 4QRR 3 D clone12 TCR beta chain 9606
262 3GSN 4 A RA14 TCR alpha chain (TRAV24, TRAJ49) 9606
263 3RZC 3 C Valpha14 mouse variable domain, human constant domain 10090
264 3O6F 3 C, G T-cell receptor alpha chain C region unp residues 1-92 9606
265 4P5T 1 A, E TRA protein 9606
266 3ARF 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
267 4Z7W 3 E, G T-CELL RECEPTOR, T316 ALPHA CHAIN 9606
268 5SWS 4 D NP1-B17 TCR alpha chain 10090
269 3ARD 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
270 4L8S 1 A Muccosal Associated Invariant T Cell Receptor alpha chain 9606
271 4NHU 1 A, C 2C m33 alpha VmCh chimera 10090
272 1QSE 4 D PROTEIN (human T-Cell receptor) 9606
273 1NFD 1 A, C N15 ALPHA-BETA T-CELL RECEPTOR 10090
274 3TFK 3 C 42F3 alpha Mouse-human chimera alpha chain 10090
275 4P2Q 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
276 2CKB 1 A, C ALPHA, BETA T CELL RECEPTOR VB8.2DB2JB2.4CB2\;VA3JA58CA EXTRACELLULAR DOMAINS 10090
277 1QSF 4 D HUMAN T-CELL RECEPTOR 9606
278 4C56 1 A, G T CELL RECEPTOR ALPHA CHAIN 9606
279 5HYJ 4 D, I Human T-cell Receptor, Class I, Light alpha Chain 9606
280 6BNK 3 C, G Human nkt tcr alpha chain 9606
281 4Y2D 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain) 10090
282 4EUP 4 G, I JKF6 alpha chain 9606
283 3HE6 3 C Valpha14(mouse variable domain, human constant domain) 10090
284 5W1W 4 D, I, N, S GF4 T cell receptor alpha chain 9606
285 3KXF 3 D, G, M, N SB27 T cell receptor alpha chain 9606
286 6CQR 4 D, I F24 alpha chain 9606
287 3HG1 4 D T-CELL RECEPTOR, ALPHA CHAIN 9606
288 3TO4 3 C NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-207 IS HUMAN CONSTANT DOMAIN 10090
289 5HHO 3 D JM22 TCR alpha chain 9606
290 2NX5 4 D, I, N, T ELS4 TCR alpha chain 9606
291 4OZI 3 E, G T-cell receptor, s2, alpha chain 9606
292 3VXU 4 D, I T36-5 TCR alpha chain 9606
293 3ARG 3 C NKT Valpha14-Jalpha18 Chimera of mouse variable domain and human constant domain 10090
294 5NHT 4 A T-cell receptor alpha variable 12-2,T-cell receptor, sp3.4 alpha chain Numbering: residue 1 match first residue of TRAV12-2 defined in IMGT. Additional sequence in C-ter (ENDGGGCK) to enhance alpha-beta chain pairing. 9606
295 4Y4F 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
296 5L2K 3 D GEM42 TCR alpha chain 9606
297 3VWJ 3 C NKT15 T cell receptor alpha-chain 9606
298 4MVB 1 C 42F3 alpha VmCh 10090
299 3TPU 1 A, C, G, M 42F3 alpha 10090
300 5IW1 1 A, C, E T-CELL RECEPTOR ALPHA CHAIN 10090
301 4P2R 4 D, I, N, S 5cc7 T-cell receptor alpha chain 10090
302 4MJI 4 D, I T-Cell Receptor Chain alpha 9606
303 4NDM 2 B Human nkt tcr alpha chain AB18.1 TCR delta chain 9606
304 3TZV 1 A, G Invariant Natural Killer T Cell Receptor chain A 9606
305 3QIW 3 C TCR 226 alpha chain unp residues 97-108 7130
306 3AXL 1 A, G Valpha 10 10090
307 3SDX 3 E, G NKT TCR Valpha24 chain 9606
308 2WBJ 3 C, G OB TCR E. COLI ENGA PEPTIDE COVALENTLY BOUND 9606
309 3TN0 3 C mouse NKT Valpha14 (MOUSE VARIABLE DOMAIN, HUMAN CONSTANT DOMAIN) FOR CHAIN C, RESIDUES 1 TO 116 IS MOUSE VARIABLE DOMAIN AND 117-210 IS HUMAN CONSTANT DOMAIN 10090
310 2PO6 3 C, G NKT15 alpha-chain 9606
311 3SDA 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
312 5TJE 3 E, G ALPHA CHAIN OF MURINE T CELL RECEPTOR p14 10090
313 3SDC 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
314 5NQK 4 A T-cell receptor alpha variable 12-2,T-cell receptor alpha joining 45,T-cell receptor alpha chain C region NUMBERING: RESIDUE 1 MATCH FIRST RESIDUE OF TRAV 12-2 DEFINED IN IMGT. ADDITIONAL SEQUENCE IN C-TER (ENDGGGCK) TO ENHANCE ALPHA-BETA CHAIN PAIRING. 9606
315 4Y4H 3 C, G Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain/ human constant domain) 10090
316 2J8U 4 E, L AHIII TCR ALPHA CHAIN ECTODOMAIN 10090
317 1ZGL 4 M, Q, S, U T cell receptor alpha chain 9606
318 4ELM 3 E, G Hy19.3 TCR alpha chain (mouse variable domain, human constant domain) 10090
319 5W1V 4 D, I, N, S GF4 T cell receptor alpha chain 9606
320 4ONH 2 A T-cell receptor beta 9606
321 3SDD 3 C NKT TCR Valpha14 chain chimera of Mouse variable domain and human constant domain 10090
322 4MNH 2 B, D Human nkt tcr alpha chain DP10.7 TCR delta variable domain fused with human TCR alpha constant domain 9606
323 3SJV 4 D, I, N, S RL42 T cell receptor, alpha chain 9606
324 4GG6 3 E, G T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
325 3PQY 4 D, I, N, S alpha chain of the 6218-TCR chimeric construct with mouse variable domain and human constant domain 10090
326 5FK9 1 A T CELL RECEPTOR ALPHA CHAIN VARIABLE DOMAIN TRAV22 AND CONSTANT DOMAIN TRAC1 IMMUNOGLOBULIN DOMAINS, RESIDUES 1-206 9606
327 3C60 1 A, E TCR YAe62 alpha chain 10090
328 1G6R 1 A, C ALPHA T CELL RECEPTOR EXTRACELLULAR DOMAIN 10090
329 4GG8 1 A, E T-CELL RECEPTOR, SP3.4 ALPHA CHAIN EXTRACELLULAR DOMAINS 9606
330 4LCC 2 A Human MAIT TCR alpha chain 9606
331 4L9L 2 A Human MAIT TCR alpha chain 9606
332 1YPZ 3 E, G T cell receptor delta 10090
333 3C6L 1 A, E TCR 2W20 alpha chain 10090
334 4Y1A 4 D FS17_alpha 9606
335 5D7L 3 D, G MAV36 TCR Alpha Chain 9606
336 5D2L 3 E, I, K, O C7 TCR alpha chain 9606
337 1YMM 4 D T cell receptor alpha chain 9606
338 3T0E 3 C T-cell receptor alpha chain 9606
339 2CDE 1 A, C, E INKT-TCR HUMAN INVARIANT NATURAL KILLER T CELL RECEPTOR VALPHA 24 AND VBETA11 9606
340 3DXA 4 D, I, N DM1 T cell receptor alpha chain 9606
341 5E6I 1 A, F, G, P TCR alpha chain,Human nkt tcr alpha chain 9606