Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 16 44 829
95 % 35 68 665
90 % 35 68 692
70 % 35 68 744
50 % 35 176 200
40 % 35 176 221
30 % 43 513 31
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 59262
95 % 1 1 41301
90 % 1 1 39301
70 % 35 68 736
50 % 35 172 209
40 % 35 172 233
30 % 35 172 238
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 418
95 % 35 74 588
90 % 35 74 619
70 % 35 74 651
50 % 35 74 696
40 % 35 74 735
30 % 42 495 37
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 416
95 % 35 74 586
90 % 35 74 617
70 % 35 74 648
50 % 35 76 666
40 % 35 76 709
30 % 35 79 678
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 475
95 % 35 68 666
90 % 35 68 694
70 % 35 68 746
50 % 35 70 763
40 % 35 70 799
30 % 35 70 788
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2182
95 % 35 68 664
90 % 35 68 690
70 % 35 68 742
50 % 35 68 793
40 % 35 72 764
30 % 35 72 755
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 476
95 % 35 68 668
90 % 35 68 696
70 % 35 68 749
50 % 35 70 765
40 % 35 70 801
30 % 35 71 772
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 67 489
95 % 35 68 662
90 % 35 68 688
70 % 35 68 739
50 % 35 68 790
40 % 35 68 825
30 % 35 175 232
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 423
95 % 35 74 592
90 % 35 74 623
70 % 35 74 657
50 % 35 76 670
40 % 35 78 692
30 % 42 402 60
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 422
95 % 35 74 591
90 % 35 74 622
70 % 35 74 656
50 % 35 180 199
40 % 35 180 217
30 % 35 180 226
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 33 70 454
95 % 33 70 638
90 % 33 70 663
70 % 33 70 717
50 % 33 70 766
40 % 33 70 804
30 % 33 70 792
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 424
95 % 35 74 593
90 % 35 74 624
70 % 35 74 658
50 % 35 74 701
40 % 35 74 738
30 % 35 74 730
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 473
95 % 35 68 663
90 % 35 68 689
70 % 35 68 740
50 % 35 68 791
40 % 35 70 796
30 % 35 71 769
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 478
95 % 35 68 670
90 % 35 68 698
70 % 35 68 751
50 % 35 68 796
40 % 35 68 829
30 % 35 68 814
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 62617
95 % 3 5 14045
90 % 3 5 13782
70 % 3 5 12926
50 % 3 5 11528
40 % 3 5 10459
30 % 3 5 9060
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 68921
95 % 1 1 47746
90 % 1 1 45380
70 % 3 21 2865
50 % 7 30 1917
40 % 7 129 302
30 % 26 152 267
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 480
95 % 35 68 673
90 % 35 68 701
70 % 35 68 755
50 % 35 69 778
40 % 35 69 815
30 % 35 69 804
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 70331
95 % 35 68 674
90 % 35 68 702
70 % 35 68 756
50 % 35 173 205
40 % 35 173 228
30 % 35 173 235
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 477
95 % 35 68 669
90 % 35 68 697
70 % 35 68 750
50 % 35 68 795
40 % 35 68 828
30 % 35 169 242
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 68 472
95 % 35 68 661
90 % 35 68 687
70 % 35 68 738
50 % 35 68 789
40 % 35 174 226
30 % 43 504 34
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2166
95 % 35 68 658
90 % 35 68 684
70 % 35 68 734
50 % 35 171 208
40 % 35 173 227
30 % 35 173 234
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 52492
95 % 35 74 577
90 % 35 74 609
70 % 35 74 643
50 % 35 74 689
40 % 35 180 215
30 % 35 180 224
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 9908
95 % 35 74 582
90 % 35 74 615
70 % 35 74 646
50 % 35 74 691
40 % 35 76 707
30 % 36 78 686
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 417
95 % 35 74 587
90 % 35 74 618
70 % 35 74 649
50 % 35 74 694
40 % 36 180 216
30 % 36 180 225
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2194
95 % 3 21 2836
90 % 35 68 693
70 % 35 68 745
50 % 50 105 322
40 % 57 122 280
30 % 57 124 282
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 61521
95 % 1 1 42557
90 % 1 7 10001
70 % 3 27 2134
50 % 35 74 695
40 % 35 79 679
30 % 35 79 680
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 419
95 % 35 74 589
90 % 35 74 620
70 % 35 74 654
50 % 35 74 700
40 % 36 77 702
30 % 36 78 689

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
54 4U3M 40 L3, l3 60S ribosomal protein L3 4932
55 1N8R 4 D 50S ribosomal protein L3P 2238
56 4U3N 40 L3, l3 60S ribosomal protein L3 4932
57 1Q81 5 D 50S ribosomal protein L3P 2238
58 1Q82 5 D 50S ribosomal protein L3P 2238
59 1QVF 5 B 50S ribosomal protein L3P 2238
60 4U52 40 L3, l3 60S ribosomal protein L3 4932
61 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
62 1NJI 4 D 50S ribosomal protein L3P 2238
63 4U6F 40 L3, l3 60S ribosomal protein L3 4932
64 4U4U 40 L3, l3 60S ribosomal protein L3 4932
65 1K73 4 D RIBOSOMAL PROTEIN L3 2238
66 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
67 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
68 4U4N 40 L3, l3 60S ribosomal protein L3 4932
69 4U55 40 L3, l3 60S ribosomal protein L3 4932
70 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
71 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
72 5DAT 40 L3, l3 60S ribosomal protein L3 4932
73 3I55 3 B 50S ribosomal protein L3P 2238
74 5I4L 40 L3, l3 60S ribosomal protein L3 4932
75 4U51 40 L3, l3 60S ribosomal protein L3 4932
76 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
77 4U53 40 L3, l3 60S ribosomal protein L3 4932
78 1Q86 5 D 50S ribosomal protein L3P 2238
79 4U50 40 L3, l3 60S ribosomal protein L3 4932
80 5LYB 40 L3, l3 60S ribosomal protein L3 4932
81 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
82 3G4S 3 B 50S ribosomal protein L3P 2238
83 3CCJ 2 B 50S ribosomal protein L3P 2238
84 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
85 4U56 40 L3, l3 60S ribosomal protein L3 4932
86 2QA4 4 B 50S ribosomal protein L3P 2238
87 5TGA 40 L3, l3 60S ribosomal protein L3 4932
88 1Q7Y 5 D 50S ribosomal protein L3P 2238
89 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
90 4U4O 40 L3, l3 60S ribosomal protein L3 4932
91 5DGV 40 L3, l3 60S ribosomal protein L3 4932
92 5DGE 40 L3, l3 60S ribosomal protein L3 4932
93 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
94 5FCI 40 L3, l3 60S ribosomal protein L3 4932
95 5DC3 40 L3, l3 60S ribosomal protein L3 4932
96 5DGF 40 L3, l3 60S ribosomal protein L3 4932
97 5TGM 40 L3, l3 60S ribosomal protein L3 4932
98 4V7R 34 BC, DC 60S ribosomal protein L3 4932
99 4V4P 5 AE 50S ribosomal protein L3 274
100 4V4R 29 BE 50S ribosomal protein L3 274
101 4V4S 29 BE 50S ribosomal protein L3 274
102 4V4T 28 BE 50S ribosomal protein L3 274
103 5UMD 5 E 60S ribosomal protein L3 5833
104 5MC6 67 BA 60S ribosomal protein L3 4932
105 5H4P 5 B 60S ribosomal protein L3 4932
106 5M1J 42 B5 60S ribosomal protein L3 4932
107 5LZS 2 B Uncharacterized protein 9986
108 5LZT 2 B uL3 9986
109 5LZU 2 B uL3 9986
110 5LZV 2 B uL3 9986
111 5LZW 2 B uL3 9986
112 5LZX 2 B Ul3 9986
113 5LZY 2 B uL3 9986
114 5LZZ 2 B uL3 9986
115 5T62 6 E 60S ribosomal protein L3 4932
116 5T6R 5 E 60S ribosomal protein L3 4932
117 5T5H 29 f Ribosomal protein L13 5693
118 5T2A 30 d uL3 5661
119 5T2C 4 E 60S ribosomal protein L3 9606
120 5LKS 5 LB 60S ribosomal protein L3 9606
121 5JUO 7 G uL3 (yeast L3) 4932
122 5JUP 7 G uL3 (yeast L3) 4932
123 5JUS 7 G uL3 (yeast L3) 4932
124 5JUT 7 G uL3 (yeast L3) 4932
125 5JUU 7 G uL3 (yeast L3) 4932
126 5JCS 3 B 60S ribosomal protein L3 4932
127 5IT7 5 BB 60S ribosomal protein L3 28985
128 3JCT 2 B 60S ribosomal protein L3 4932
129 3JCS 10 B ribosomal protein L3 5661
130 5GAK 17 F 60S ribosomal protein L3 4932
131 5FL8 2 B 60S ribosomal protein L3 4932
132 5APN 5 B 60S ribosomal protein L3 4932
133 5APO 5 B 60S ribosomal protein L3 4932
134 3JBN 70 AE 60S ribosomal protein uL3 5833
135 3JBO 70 AE 60S ribosomal protein uL3 5833
136 3JBP 70 AE 60S ribosomal protein uL3 5833
137 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
138 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
139 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
140 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
141 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
142 3JAG 2 B uL3 9986
143 3JAH 2 B uL3 9986
144 3JAI 2 B uL3 9986
145 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
146 5AJ0 4 AB 60S ribosomal protein L3 9606
147 3J92 2 B uL3 9986
148 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
149 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
150 4V3P 80 LC Ribosomal protein L3 4565
151 3J7O 5 B Ribosomal protein uL3 9823
152 3J7P 5 B Ribosomal protein uL3 9823
153 3J7Q 5 B Ribosomal protein uL3 9823
154 3J7R 5 B Ribosomal protein uL3 9823
155 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
156 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
157 3J79 5 E 60S ribosomal protein uL3 5833
158 3J77 3 L3 60S ribosomal protein L3 4932
159 3J78 3 L3 60S ribosomal protein L3 4932
160 3J6X 6 L3 60S ribosomal protein L3 4932
161 3J6Y 6 L3 60S ribosomal protein L3 4932
162 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
163 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
164 4V7F 6 C 60S ribosomal protein L3 4932
165 4V7E 71 CB 60S ribosomal protein L3 4565
166 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
167 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
168 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
169 4V6W 63 CB 60S ribosomal protein L3 7227
170 4V6X 63 CB 60S ribosomal protein L3 9606
171 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
172 4V6U 33 BC 50S ribosomal protein L3P 2261
173 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
174 4ADX 12 B RPL3 145262
175 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
176 4V7H 27 BC 60S ribosomal protein L3 5541
177 4V5Z 54 Bb 60S Ribosomal protein L3 9612
178 4V4B 22 BC 60S ribosomal protein L3 4932
179 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
180 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274