Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 846
95 % 35 68 676 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 706
70 % 35 68 761
50 % 35 177 202
40 % 43 531 20
30 % 43 531 33
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 60136
95 % 1 1 41940
90 % 1 1 39881
70 % 35 68 751
50 % 35 173 209
40 % 35 173 230
30 % 35 173 239
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 431
95 % 35 74 603 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 632
70 % 35 74 669
50 % 35 74 714
40 % 35 74 747
30 % 42 511 37
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 429
95 % 35 74 601 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 630
70 % 35 74 666
50 % 35 76 688
40 % 35 76 721
30 % 35 79 686
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 487
95 % 35 68 677 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 708
70 % 35 68 763
50 % 35 70 775
40 % 35 70 807
30 % 35 70 798
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2224
95 % 35 68 674 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 703
70 % 35 68 758
50 % 35 68 805
40 % 35 72 778
30 % 35 72 770
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 489
95 % 35 68 681 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 712
70 % 35 68 767
50 % 35 70 776
40 % 35 70 808
30 % 35 71 783
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 504
95 % 35 68 672 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 701
70 % 35 68 755
50 % 35 68 802
40 % 35 68 837
30 % 35 176 231
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 436
95 % 35 74 608 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 637
70 % 35 74 677
50 % 35 76 692
40 % 35 78 701
30 % 42 417 61
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 435
95 % 35 74 607 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 636
70 % 35 74 675
50 % 35 181 200
40 % 35 181 219
30 % 35 181 227
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 464
95 % 33 70 653 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.3
PDBFlex
90 % 33 70 679
70 % 33 70 733
50 % 33 70 779
40 % 33 70 812
30 % 33 70 802
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 437
95 % 35 74 609
90 % 35 74 638
70 % 35 74 678
50 % 35 74 722
40 % 42 381 58
30 % 42 407 65
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 485
95 % 35 68 673 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 702
70 % 35 68 756
50 % 35 68 803
40 % 35 70 804
30 % 35 71 781
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 491
95 % 35 68 683 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 714
70 % 35 68 769
50 % 35 68 811
40 % 35 68 844
30 % 35 68 831
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 63501
95 % 3 5 14264 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 13993
70 % 3 5 13129
50 % 3 5 11685
40 % 3 5 10598
30 % 3 5 9190
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 69819
95 % 1 1 48393
90 % 1 1 45966
70 % 3 21 2915
50 % 7 30 1938
40 % 7 130 299
30 % 26 153 268
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 493
95 % 35 68 686 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 717
70 % 35 68 772
50 % 35 69 792
40 % 35 69 826
30 % 35 69 816
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 71234
95 % 35 68 687 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 718
70 % 35 68 773
50 % 35 174 205
40 % 35 174 229
30 % 35 174 238
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 490
95 % 35 68 682 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.4
PDBFlex
90 % 35 68 713
70 % 35 68 768
50 % 35 68 810
40 % 35 68 843
30 % 35 170 242
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 484
95 % 35 68 671 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 699
70 % 35 68 753
50 % 35 68 801
40 % 35 175 224
30 % 43 522 36
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2207
95 % 35 68 669 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 697
70 % 35 68 750
50 % 35 172 208
40 % 35 174 228
30 % 35 174 236
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 53317
95 % 35 74 593 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 624
70 % 35 74 662
50 % 35 74 708
40 % 35 181 217
30 % 35 181 225
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10078
95 % 35 74 597 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 628
70 % 35 74 664
50 % 35 74 710
40 % 35 76 719
30 % 36 78 693
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 430
95 % 35 74 602 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 631
70 % 35 74 667
50 % 35 74 712
40 % 36 181 218
30 % 36 181 226
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2238
95 % 3 21 2881 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 707
70 % 35 68 762
50 % 50 105 334
40 % 57 123 282
30 % 57 125 289
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 62404
95 % 1 1 43202
90 % 1 7 10170
70 % 3 27 2169
50 % 35 74 713
40 % 35 79 691
30 % 35 79 688
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 432
95 % 35 74 604 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 633
70 % 35 74 672
50 % 35 74 718
40 % 36 77 714
30 % 36 78 697

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
54 4U3M 40 L3, l3 60S ribosomal protein L3 4932
55 1N8R 4 D 50S ribosomal protein L3P 2238
56 4U3N 40 L3, l3 60S ribosomal protein L3 4932
57 1Q81 5 D 50S ribosomal protein L3P 2238
58 1Q82 5 D 50S ribosomal protein L3P 2238
59 1QVF 5 B 50S ribosomal protein L3P 2238
60 4U52 40 L3, l3 60S ribosomal protein L3 4932
61 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
62 1NJI 4 D 50S ribosomal protein L3P 2238
63 4U6F 40 L3, l3 60S ribosomal protein L3 4932
64 4U4U 40 L3, l3 60S ribosomal protein L3 4932
65 1K73 4 D RIBOSOMAL PROTEIN L3 2238
66 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
67 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
68 4U4N 40 L3, l3 60S ribosomal protein L3 4932
69 4U55 40 L3, l3 60S ribosomal protein L3 4932
70 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
71 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
72 5DAT 40 L3, l3 60S ribosomal protein L3 4932
73 3I55 3 B 50S ribosomal protein L3P 2238
74 5I4L 40 L3, l3 60S ribosomal protein L3 4932
75 4U51 40 L3, l3 60S ribosomal protein L3 4932
76 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
77 4U53 40 L3, l3 60S ribosomal protein L3 4932
78 1Q86 5 D 50S ribosomal protein L3P 2238
79 4U50 40 L3, l3 60S ribosomal protein L3 4932
80 5LYB 40 L3, l3 60S ribosomal protein L3 4932
81 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
82 3G4S 3 B 50S ribosomal protein L3P 2238
83 3CCJ 2 B 50S ribosomal protein L3P 2238
84 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
85 4U56 40 L3, l3 60S ribosomal protein L3 4932
86 2QA4 4 B 50S ribosomal protein L3P 2238
87 5TGA 40 L3, l3 60S ribosomal protein L3 4932
88 5MEI 5 CE, k 60S ribosomal protein L3 4932
89 1Q7Y 5 D 50S ribosomal protein L3P 2238
90 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
91 4U4O 40 L3, l3 60S ribosomal protein L3 4932
92 5DGV 40 L3, l3 60S ribosomal protein L3 4932
93 5DGE 40 L3, l3 60S ribosomal protein L3 4932
94 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
95 5FCI 40 L3, l3 60S ribosomal protein L3 4932
96 5DC3 40 L3, l3 60S ribosomal protein L3 4932
97 5DGF 40 L3, l3 60S ribosomal protein L3 4932
98 5TGM 40 L3, l3 60S ribosomal protein L3 4932
99 4V7R 34 BC, DC 60S ribosomal protein L3 4932
100 4V4P 5 AE 50S ribosomal protein L3 274
101 4V4R 29 BE 50S ribosomal protein L3 274
102 4V4S 29 BE 50S ribosomal protein L3 274
103 4V4T 28 BE 50S ribosomal protein L3 274
104 5UMD 5 E 60S ribosomal protein L3 5833
105 5MC6 67 BA 60S ribosomal protein L3 4932
106 5H4P 5 B 60S ribosomal protein L3 4932
107 5M1J 42 B5 60S ribosomal protein L3 4932
108 5LZS 2 B Uncharacterized protein 9986
109 5LZT 2 B uL3 9986
110 5LZU 2 B uL3 9986
111 5LZV 2 B uL3 9986
112 5LZW 2 B uL3 9986
113 5LZX 2 B Ul3 9986
114 5LZY 2 B uL3 9986
115 5LZZ 2 B uL3 9986
116 5T62 6 E 60S ribosomal protein L3 4932
117 5T6R 5 E 60S ribosomal protein L3 4932
118 5T5H 29 f Ribosomal protein L13 5693
119 5T2A 30 d uL3 5661
120 5T2C 4 E 60S ribosomal protein L3 9606
121 5LKS 5 LB 60S ribosomal protein L3 9606
122 5JUO 7 G uL3 (yeast L3) 4932
123 5JUP 7 G uL3 (yeast L3) 4932
124 5JUS 7 G uL3 (yeast L3) 4932
125 5JUT 7 G uL3 (yeast L3) 4932
126 5JUU 7 G uL3 (yeast L3) 4932
127 5JCS 3 B 60S ribosomal protein L3 4932
128 5IT7 5 BB 60S ribosomal protein L3 28985
129 3JCT 2 B 60S ribosomal protein L3 4932
130 3JCS 10 B ribosomal protein L3 5661
131 5GAK 17 F 60S ribosomal protein L3 4932
132 5FL8 2 B 60S ribosomal protein L3 4932
133 5APN 5 B 60S ribosomal protein L3 4932
134 5APO 5 B 60S ribosomal protein L3 4932
135 3JBN 70 AE 60S ribosomal protein uL3 5833
136 3JBO 70 AE 60S ribosomal protein uL3 5833
137 3JBP 70 AE 60S ribosomal protein uL3 5833
138 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
139 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
140 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
141 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
142 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
143 3JAG 2 B uL3 9986
144 3JAH 2 B uL3 9986
145 3JAI 2 B uL3 9986
146 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
147 5AJ0 4 AB 60S ribosomal protein L3 9606
148 3J92 2 B uL3 9986
149 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
150 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
151 4V3P 80 LC Ribosomal protein L3 4565
152 3J7O 5 B Ribosomal protein uL3 9823
153 3J7P 5 B Ribosomal protein uL3 9823
154 3J7Q 5 B Ribosomal protein uL3 9823
155 3J7R 5 B Ribosomal protein uL3 9823
156 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
157 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
158 3J79 5 E 60S ribosomal protein uL3 5833
159 3J77 3 L3 60S ribosomal protein L3 4932
160 3J78 3 L3 60S ribosomal protein L3 4932
161 3J6X 6 L3 60S ribosomal protein L3 4932
162 3J6Y 6 L3 60S ribosomal protein L3 4932
163 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
164 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
165 4V7F 6 C 60S ribosomal protein L3 4932
166 4V7E 71 CB 60S ribosomal protein L3 4565
167 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
168 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
169 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
170 4V6W 63 CB 60S ribosomal protein L3 7227
171 4V6X 63 CB 60S ribosomal protein L3 9606
172 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
173 4V6U 33 BC 50S ribosomal protein L3P 2261
174 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
175 4ADX 12 B RPL3 145262
176 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
177 4V7H 27 BC 60S ribosomal protein L3 5541
178 4V5Z 54 Bb 60S Ribosomal protein L3 9612
179 4V4B 22 BC 60S ribosomal protein L3 4932
180 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
181 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274