Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 17 44 742
95 % 36 68 527
90 % 36 68 555
70 % 36 68 609
50 % 36 141 223
40 % 36 141 254
30 % 44 428 34
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 54386
95 % 1 1 37981
90 % 1 1 36183
70 % 36 68 603
50 % 36 136 236
40 % 36 136 263
30 % 36 136 275
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 311
95 % 36 74 462
90 % 36 74 489
70 % 36 74 534
50 % 36 74 621
40 % 36 74 664
30 % 43 417 41
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 309
95 % 36 74 460
90 % 36 74 487
70 % 36 74 531
50 % 36 76 590
40 % 36 76 640
30 % 36 78 615
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 355
95 % 36 68 529
90 % 36 68 558
70 % 36 68 611
50 % 36 70 673
40 % 36 70 715
30 % 36 70 717
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1928
95 % 36 68 526
90 % 36 68 554
70 % 36 68 608
50 % 36 68 702
40 % 36 70 712
30 % 36 71 699
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 356
95 % 36 68 530
90 % 36 68 559
70 % 36 68 612
50 % 36 70 675
40 % 36 70 717
30 % 36 71 702
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 67 365
95 % 36 68 524
90 % 36 68 552
70 % 36 68 606
50 % 36 68 699
40 % 36 68 733
30 % 36 140 266
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 316
95 % 36 74 468
90 % 36 74 496
70 % 36 74 541
50 % 36 76 592
40 % 36 78 613
30 % 43 359 54
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 314
95 % 36 74 466
90 % 36 74 494
70 % 36 74 539
50 % 36 145 214
40 % 36 145 245
30 % 36 145 256
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 70 341
95 % 34 70 507
90 % 34 70 532
70 % 34 70 583
50 % 34 70 676
40 % 34 70 718
30 % 34 70 719
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 317
95 % 36 74 469
90 % 36 74 497
70 % 36 74 542
50 % 36 74 627
40 % 36 74 670
30 % 36 74 664
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 352
95 % 36 68 525
90 % 36 68 553
70 % 36 68 607
50 % 36 68 700
40 % 36 70 711
30 % 36 71 698
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 358
95 % 36 68 532
90 % 36 68 561
70 % 36 68 614
50 % 36 68 704
40 % 36 68 736
30 % 36 68 736
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 57530
95 % 3 5 12801
90 % 3 5 12559
70 % 3 5 11819
50 % 3 5 10592
40 % 3 5 9666
30 % 3 5 8412
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63523
95 % 1 1 44095
90 % 1 1 42013
70 % 3 21 2574
50 % 7 30 1732
40 % 7 94 377
30 % 26 117 327
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 360
95 % 36 68 534
90 % 36 68 563
70 % 36 68 616
50 % 36 69 690
40 % 36 69 728
30 % 36 69 731
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 64867
95 % 36 68 536
90 % 36 68 564
70 % 36 68 617
50 % 36 138 228
40 % 36 138 261
30 % 36 138 272
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 357
95 % 36 68 531
90 % 36 68 560
70 % 36 68 613
50 % 36 68 703
40 % 36 68 735
30 % 36 136 276
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 351
95 % 36 68 523
90 % 36 68 551
70 % 36 68 605
50 % 36 68 698
40 % 36 140 256
30 % 44 423 38
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1904
95 % 36 68 521
90 % 36 68 549
70 % 36 68 602
50 % 36 136 235
40 % 36 138 259
30 % 36 138 271
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 48090
95 % 36 74 452
90 % 36 74 480
70 % 36 74 526
50 % 36 74 614
40 % 36 145 242
30 % 36 145 252
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 8939
95 % 36 74 455
90 % 36 74 483
70 % 36 74 529
50 % 36 74 616
40 % 36 76 639
30 % 36 77 624
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 310
95 % 36 74 461
90 % 36 74 488
70 % 36 74 532
50 % 36 74 619
40 % 37 145 244
30 % 37 145 255
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1939
95 % 3 21 2519
90 % 36 68 557
70 % 36 68 610
50 % 51 96 345
40 % 58 110 307
30 % 58 112 322
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 56508
95 % 1 1 39163
90 % 1 7 9098
70 % 3 27 1891
50 % 36 74 620
40 % 36 79 601
30 % 36 79 605
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 312
95 % 36 74 463
90 % 36 74 491
70 % 36 74 536
50 % 36 74 624
40 % 37 77 624
30 % 37 78 618

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CCJ 2 B 50S ribosomal protein L3P 2238
20 3CC7 2 B 50S ribosomal protein L3P 2238
21 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
22 3CCE 2 B 50S ribosomal protein L3P 2238
23 3G6E 3 B 50S ribosomal protein L3P 2238
24 3CPW 4 B 50S ribosomal protein L3P 2238
25 3CCU 2 B 50S ribosomal protein L3P 2238
26 1VQ6 6 B 50S ribosomal protein L3P 2238
27 1M90 5 D RIBOSOMAL PROTEIN L3 2238
28 3CCL 2 B 50S ribosomal protein L3P 2238
29 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
30 1YJ9 4 B 50S ribosomal protein L3P 2238
31 3CD6 2 B 50S ribosomal protein L3P 2238
32 3CCV 2 B 50S ribosomal protein L3P 2238
33 3CC4 2 B 50S ribosomal protein L3P 2238
34 2OTL 4 B 50S ribosomal protein L3P 2238
35 3G71 3 B 50S ribosomal protein L3P 2238
36 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
37 1VQ4 5 B 50S ribosomal protein L3P 2238
38 1YJN 4 B 50S ribosomal protein L3P 2238
39 3CMA 2 B 50S ribosomal protein L3P 2238
40 3CCS 2 B 50S ribosomal protein L3P 2238
41 3CCQ 2 B 50S ribosomal protein L3P 2238
42 3I56 2 B 50S ribosomal protein L3P 2238
43 3CCR 2 B 50S ribosomal protein L3P 2238
44 2OTJ 4 B 50S ribosomal protein L3P 2238
45 4V88 40 BB, DB 60S ribosomal protein L3 4932
46 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
47 3OW2 4 B 50S ribosomal protein L3P 2238
48 4U4R 40 L3, l3 60S ribosomal protein L3 4932
49 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
50 1QVG 5 B 50S ribosomal protein L3P 2238
51 3CME 2 B 50S ribosomal protein L3P 2238
52 2QEX 4 B 50S ribosomal protein L3P 2238
53 4U3U 40 L3, l3 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 3I55 3 B 50S ribosomal protein L3P 2238
74 4U51 40 L3, l3 60S ribosomal protein L3 4932
75 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
76 4U53 40 L3, l3 60S ribosomal protein L3 4932
77 1Q86 5 D 50S ribosomal protein L3P 2238
78 4U50 40 L3, l3 60S ribosomal protein L3 4932
79 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
80 3G4S 3 B 50S ribosomal protein L3P 2238
81 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
82 4U56 40 L3, l3 60S ribosomal protein L3 4932
83 2QA4 4 B 50S ribosomal protein L3P 2238
84 1Q7Y 5 D 50S ribosomal protein L3P 2238
85 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
86 4U4O 40 L3, l3 60S ribosomal protein L3 4932
87 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
88 5FCI 40 L3, l3 60S ribosomal protein L3 4932
89 4V7R 34 BC, DC 60S ribosomal protein L3 4932
90 4V4P 5 AE 50S ribosomal protein L3 274
91 4V4R 29 BE 50S ribosomal protein L3 274
92 4V4S 29 BE 50S ribosomal protein L3 274
93 4V4T 28 BE 50S ribosomal protein L3 274
94 5IT7 5 BB 60S ribosomal protein L3 28985
95 5GAK 17 F 60S ribosomal protein L3 4932
96 5FL8 2 B 60S ribosomal protein L3 4932
97 5APN 5 B 60S ribosomal protein L3 4932
98 5APO 5 B 60S ribosomal protein L3 4932
99 3JBN 70 AE 60S ribosomal protein uL3 5833
100 3JBO 70 AE 60S ribosomal protein uL3 5833
101 3JBP 70 AE 60S ribosomal protein uL3 5833
102 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
103 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
104 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
105 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
106 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
107 3JAG 2 B uL3 9986
108 3JAH 2 B uL3 9986
109 3JAI 2 B uL3 9986
110 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
111 5AJ0 4 AB 60S ribosomal protein L3 9606
112 3J92 2 B uL3 9986
113 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
114 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
115 4V3P 80 LC Ribosomal protein L3 4565
116 3J7O 5 B Ribosomal protein uL3 9823
117 3J7P 5 B Ribosomal protein uL3 9823
118 3J7Q 5 B Ribosomal protein uL3 9823
119 3J7R 5 B Ribosomal protein uL3 9823
120 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
121 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
122 3J79 5 E 60S ribosomal protein uL3 5833
123 3J77 3 L3 60S ribosomal protein L3 4932
124 3J78 3 L3 60S ribosomal protein L3 4932
125 3J6X 6 L3 60S ribosomal protein L3 4932
126 3J6Y 6 L3 60S ribosomal protein L3 4932
127 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
128 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
129 4V7F 6 C 60S ribosomal protein L3 4932
130 4V7E 71 CB 60S ribosomal protein L3 4565
131 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
132 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
133 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
134 4V6W 63 CB 60S ribosomal protein L3 7227
135 4V6X 63 CB 60S ribosomal protein L3 9606
136 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
137 4V6U 33 BC 50S ribosomal protein L3P 2261
138 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
139 4ADX 12 B RPL3 145262
140 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
141 4V7H 27 BC 60S ribosomal protein L3 5541
142 4V5Z 54 Bb 60S Ribosomal protein L3 9612
143 4V4B 22 BC 60S ribosomal protein L3 4932
144 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
145 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274