Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 901
95 % 35 68 722 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 754
70 % 35 68 801
50 % 35 190 200
40 % 43 562 20
30 % 43 562 35
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63068
95 % 1 1 43973
90 % 1 1 41727
70 % 35 68 792
50 % 35 187 201
40 % 35 187 221
30 % 35 187 231
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 463
95 % 35 74 642 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 669
70 % 35 74 715
50 % 35 74 767
40 % 35 74 804
30 % 42 539 41
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 461
95 % 35 74 640 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 667
70 % 35 74 712
50 % 35 76 743
40 % 35 76 779
30 % 35 79 738
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 531
95 % 35 68 724 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 757
70 % 35 68 804
50 % 35 70 815
40 % 35 70 856
30 % 35 70 839
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2382
95 % 35 68 720 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 753
70 % 35 68 800
50 % 35 68 846
40 % 35 72 826
30 % 35 72 814
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 532
95 % 35 68 726 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 759
70 % 35 68 806
50 % 35 70 816
40 % 35 70 857
30 % 35 71 827
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 544
95 % 35 68 718 Flexibility: No
Max RMSD: 5.1, Avg RMSD: 0.4
PDBFlex
90 % 35 68 751
70 % 35 68 797
50 % 35 68 843
40 % 35 68 882
30 % 35 190 227
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 469
95 % 35 74 647 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 674
70 % 35 74 718
50 % 35 76 748
40 % 35 78 758
30 % 42 435 61
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 468
95 % 35 74 645 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 673
70 % 35 74 717
50 % 35 194 198
40 % 35 195 210
30 % 35 195 222
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 501
95 % 33 70 696 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 724
70 % 33 70 767
50 % 33 70 817
40 % 33 70 858
30 % 33 70 841
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 470
95 % 35 74 648 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 675
70 % 35 74 719
50 % 35 74 771
40 % 42 396 53
30 % 42 422 67
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 529
95 % 35 68 719 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 752
70 % 35 68 798
50 % 35 68 844
40 % 35 70 855
30 % 35 71 824
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 534
95 % 35 68 728 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 761
70 % 35 68 808
50 % 35 68 851
40 % 35 68 885
30 % 35 68 867
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 66605
95 % 3 5 14999 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 14726
70 % 3 5 13818
50 % 3 5 12268
40 % 3 5 11121
30 % 3 5 9655
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 73171
95 % 1 1 50693
90 % 1 1 48055
70 % 3 21 3076
50 % 7 30 2056
40 % 7 140 283
30 % 26 163 253
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 535
95 % 35 68 729 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 762
70 % 35 68 809
50 % 35 69 830
40 % 35 69 870
30 % 35 69 853
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 74639
95 % 35 68 730 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 763
70 % 35 68 810
50 % 35 183 205
40 % 35 183 224
30 % 35 183 238
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 533
95 % 35 68 727 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.4
PDBFlex
90 % 35 68 760
70 % 35 68 807
50 % 35 68 850
40 % 35 68 884
30 % 35 179 241
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 528
95 % 35 68 717 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 749
70 % 35 68 795
50 % 35 68 842
40 % 35 187 220
30 % 43 552 40
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2364
95 % 35 68 715 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 747
70 % 35 68 791
50 % 35 181 206
40 % 35 183 223
30 % 35 183 236
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 55910
95 % 35 74 631 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 661
70 % 35 74 707
50 % 35 74 759
40 % 35 194 211
30 % 35 194 223
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10616
95 % 35 74 634 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 664
70 % 35 74 709
50 % 35 74 761
40 % 35 76 774
30 % 36 78 752
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 462
95 % 35 74 641 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 668
70 % 35 74 713
50 % 35 74 765
40 % 36 190 216
30 % 36 190 228
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2395
95 % 3 21 3049 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 756
70 % 35 68 803
50 % 51 107 374
40 % 58 128 282
30 % 58 130 288
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 65434
95 % 1 1 45293
90 % 1 7 10686
70 % 3 27 2296
50 % 35 74 766
40 % 35 79 744
30 % 35 79 741
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 465
95 % 35 74 643
90 % 35 74 670
70 % 35 74 716
50 % 35 74 770
40 % 36 77 768
30 % 36 78 758

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 1Q86 5 D 50S ribosomal protein L3P 2238
81 4U50 40 L3, l3 60S ribosomal protein L3 4932
82 5NDV 5 L3, l3 60S ribosomal protein L3 4932
83 5LYB 40 L3, l3 60S ribosomal protein L3 4932
84 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
85 3G4S 3 B 50S ribosomal protein L3P 2238
86 3CCJ 2 B 50S ribosomal protein L3P 2238
87 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
88 4U56 40 L3, l3 60S ribosomal protein L3 4932
89 2QA4 4 B 50S ribosomal protein L3P 2238
90 5TGA 40 L3, l3 60S ribosomal protein L3 4932
91 5MEI 5 CE, k 60S ribosomal protein L3 4932
92 1Q7Y 5 D 50S ribosomal protein L3P 2238
93 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
94 4U4O 40 L3, l3 60S ribosomal protein L3 4932
95 5DGV 40 L3, l3 60S ribosomal protein L3 4932
96 5DGE 40 L3, l3 60S ribosomal protein L3 4932
97 5NDW 28 L3, l3 60S ribosomal protein L3 4932
98 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
99 5NDG 40 L3, l3 60S ribosomal protein L3 4932
100 5FCI 40 L3, l3 60S ribosomal protein L3 4932
101 5DC3 40 L3, l3 60S ribosomal protein L3 4932
102 5DGF 40 L3, l3 60S ribosomal protein L3 4932
103 5TGM 40 L3, l3 60S ribosomal protein L3 4932
104 4V7R 34 BC, DC 60S ribosomal protein L3 4932
105 4V4P 5 AE 50S ribosomal protein L3 274
106 4V4R 29 BE 50S ribosomal protein L3 274
107 4V4S 29 BE 50S ribosomal protein L3 274
108 4V4T 28 BE 50S ribosomal protein L3 274
109 6EM1 16 B 60S ribosomal protein L3 4932
110 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
111 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
112 6ELZ 28 B 60S ribosomal protein L3 4932
113 6EK0 5 LB 60S ribosomal protein L3 9606
114 6AZ3 2 B ribosomal protein uL3 5661
115 5XY3 5 B Uncharacterized protein 5722
116 5XXB 5 B Ribosomal protein uL3 5811
117 5UMD 5 E 60S ribosomal protein L3 5833
118 5MC6 67 BA 60S ribosomal protein L3 4932
119 5H4P 5 B 60S ribosomal protein L3 4932
120 5M1J 42 B5 60S ribosomal protein L3 4932
121 5LZS 2 B Uncharacterized protein 9986
122 5LZT 2 B uL3 9986
123 5LZU 2 B uL3 9986
124 5LZV 2 B uL3 9986
125 5LZW 2 B uL3 9986
126 5LZX 2 B Ul3 9986
127 5LZY 2 B uL3 9986
128 5LZZ 2 B uL3 9986
129 5T62 6 E 60S ribosomal protein L3 4932
130 5T6R 5 E 60S ribosomal protein L3 4932
131 5T5H 29 f Ribosomal protein L13 5693
132 5T2A 30 d uL3 5661
133 5T2C 4 E 60S ribosomal protein L3 9606
134 5LKS 5 LB 60S ribosomal protein L3 9606
135 5JUO 7 G uL3 (yeast L3) 4932
136 5JUP 7 G uL3 (yeast L3) 4932
137 5JUS 7 G uL3 (yeast L3) 4932
138 5JUT 7 G uL3 (yeast L3) 4932
139 5JUU 7 G uL3 (yeast L3) 4932
140 5JCS 3 B 60S ribosomal protein L3 4932
141 5IT7 5 BB 60S ribosomal protein L3 28985
142 3JCT 2 B 60S ribosomal protein L3 4932
143 3JCS 10 B ribosomal protein L3 5661
144 5GAK 17 F 60S ribosomal protein L3 4932
145 5FL8 2 B 60S ribosomal protein L3 4932
146 5APN 5 B 60S ribosomal protein L3 4932
147 5APO 5 B 60S ribosomal protein L3 4932
148 3JBN 70 AE 60S ribosomal protein uL3 5833
149 3JBO 70 AE 60S ribosomal protein uL3 5833
150 3JBP 70 AE 60S ribosomal protein uL3 5833
151 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
152 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
153 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
154 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
155 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
156 3JAG 2 B uL3 9986
157 3JAH 2 B uL3 9986
158 3JAI 2 B uL3 9986
159 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
160 5AJ0 4 AB 60S ribosomal protein L3 9606
161 3J92 2 B uL3 9986
162 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
163 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
164 4V3P 80 LC Ribosomal protein L3 4565
165 3J7O 5 B Ribosomal protein uL3 9823
166 3J7P 5 B Ribosomal protein uL3 9823
167 3J7Q 5 B Ribosomal protein uL3 9823
168 3J7R 5 B Ribosomal protein uL3 9823
169 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
170 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
171 3J79 5 E 60S ribosomal protein uL3 5833
172 3J77 3 L3 60S ribosomal protein L3 4932
173 3J78 3 L3 60S ribosomal protein L3 4932
174 3J6X 6 L3 60S ribosomal protein L3 4932
175 3J6Y 6 L3 60S ribosomal protein L3 4932
176 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
177 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
178 4V7F 6 C 60S ribosomal protein L3 4932
179 4V7E 71 CB 60S ribosomal protein L3 4565
180 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
181 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
182 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
183 4V6W 63 CB 60S ribosomal protein L3 7227
184 4V6X 63 CB 60S ribosomal protein L3 9606
185 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
186 4V6U 33 BC 50S ribosomal protein L3P 2261
187 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
188 4ADX 12 B RPL3 145262
189 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
190 4V7H 27 BC 60S ribosomal protein L3 5541
191 4V5Z 54 Bb 60S Ribosomal protein L3 9612
192 4V4B 22 BC 60S ribosomal protein L3 4932
193 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
194 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274