Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 17 44 754
95 % 36 68 537
90 % 36 68 564
70 % 36 68 615
50 % 36 145 219
40 % 36 145 247
30 % 44 439 33
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 55066
95 % 1 1 38429
90 % 1 1 36618
70 % 36 68 609
50 % 36 140 231
40 % 36 140 259
30 % 36 140 269
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 318
95 % 36 74 471
90 % 36 74 499
70 % 36 74 544
50 % 36 74 631
40 % 36 74 674
30 % 43 428 37
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 315
95 % 36 74 468
90 % 36 74 496
70 % 36 74 540
50 % 36 76 609
40 % 36 76 652
30 % 36 78 637
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 361
95 % 36 68 538
90 % 36 68 566
70 % 36 68 617
50 % 36 70 678
40 % 36 70 721
30 % 36 70 727
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1967
95 % 36 68 536
90 % 36 68 563
70 % 36 68 614
50 % 36 68 706
40 % 36 70 719
30 % 36 71 710
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 362
95 % 36 68 539
90 % 36 68 568
70 % 36 68 619
50 % 36 70 680
40 % 36 70 723
30 % 36 71 713
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 67 371
95 % 36 68 534
90 % 36 68 561
70 % 36 68 612
50 % 36 68 703
40 % 36 68 740
30 % 36 144 257
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 323
95 % 36 74 476
90 % 36 74 505
70 % 36 74 551
50 % 36 76 611
40 % 36 78 628
30 % 43 366 54
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 321
95 % 36 74 474
90 % 36 74 503
70 % 36 74 549
50 % 36 149 215
40 % 36 149 240
30 % 36 149 252
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 70 345
95 % 34 70 514
90 % 34 70 540
70 % 34 70 590
50 % 34 70 681
40 % 34 70 724
30 % 34 70 728
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 324
95 % 36 74 477
90 % 36 74 506
70 % 36 74 552
50 % 36 74 637
40 % 36 74 679
30 % 36 74 677
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 359
95 % 36 68 535
90 % 36 68 562
70 % 36 68 613
50 % 36 68 704
40 % 36 70 718
30 % 36 71 709
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 364
95 % 36 68 541
90 % 36 68 570
70 % 36 68 621
50 % 36 68 708
40 % 36 68 744
30 % 36 68 747
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 58262
95 % 3 5 12992
90 % 3 5 12753
70 % 3 5 12001
50 % 3 5 10746
40 % 3 5 9787
30 % 3 5 8520
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 64321
95 % 1 1 44627
90 % 1 1 42509
70 % 3 21 2614
50 % 7 30 1756
40 % 7 98 361
30 % 26 121 312
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 365
95 % 36 68 542
90 % 36 68 571
70 % 36 68 622
50 % 36 69 694
40 % 36 69 735
30 % 36 69 741
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 65673
95 % 36 68 544
90 % 36 68 572
70 % 36 68 623
50 % 36 142 226
40 % 36 142 256
30 % 36 142 263
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 363
95 % 36 68 540
90 % 36 68 569
70 % 36 68 620
50 % 36 68 707
40 % 36 68 743
30 % 36 139 271
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 358
95 % 36 68 533
90 % 36 68 560
70 % 36 68 611
50 % 36 68 702
40 % 36 144 248
30 % 44 434 36
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1945
95 % 36 68 531
90 % 36 68 558
70 % 36 68 608
50 % 36 140 230
40 % 36 142 255
30 % 36 142 261
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 48689
95 % 36 74 461
90 % 36 74 490
70 % 36 74 536
50 % 36 74 622
40 % 36 149 235
30 % 36 149 247
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 9065
95 % 36 74 464
90 % 36 74 493
70 % 36 74 539
50 % 36 74 625
40 % 36 76 651
30 % 36 77 643
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 317
95 % 36 74 470
90 % 36 74 498
70 % 36 74 542
50 % 36 74 629
40 % 37 150 233
30 % 37 150 246
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1976
95 % 3 21 2571
90 % 36 68 565
70 % 36 68 616
50 % 51 97 347
40 % 58 111 309
30 % 58 113 323
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 57223
95 % 1 1 39634
90 % 1 7 9235
70 % 3 27 1917
50 % 36 74 630
40 % 36 79 615
30 % 36 79 625
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 319
95 % 36 74 472
90 % 36 74 501
70 % 36 74 547
50 % 36 74 634
40 % 37 77 640
30 % 37 78 640

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CCJ 2 B 50S ribosomal protein L3P 2238
20 3CC7 2 B 50S ribosomal protein L3P 2238
21 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
22 3CCE 2 B 50S ribosomal protein L3P 2238
23 3G6E 3 B 50S ribosomal protein L3P 2238
24 3CPW 4 B 50S ribosomal protein L3P 2238
25 3CCU 2 B 50S ribosomal protein L3P 2238
26 1VQ6 6 B 50S ribosomal protein L3P 2238
27 1M90 5 D RIBOSOMAL PROTEIN L3 2238
28 3CCL 2 B 50S ribosomal protein L3P 2238
29 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
30 1YJ9 4 B 50S ribosomal protein L3P 2238
31 3CD6 2 B 50S ribosomal protein L3P 2238
32 3CCV 2 B 50S ribosomal protein L3P 2238
33 3CC4 2 B 50S ribosomal protein L3P 2238
34 2OTL 4 B 50S ribosomal protein L3P 2238
35 3G71 3 B 50S ribosomal protein L3P 2238
36 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
37 1VQ4 5 B 50S ribosomal protein L3P 2238
38 1YJN 4 B 50S ribosomal protein L3P 2238
39 3CMA 2 B 50S ribosomal protein L3P 2238
40 3CCS 2 B 50S ribosomal protein L3P 2238
41 3CCQ 2 B 50S ribosomal protein L3P 2238
42 3I56 2 B 50S ribosomal protein L3P 2238
43 3CCR 2 B 50S ribosomal protein L3P 2238
44 2OTJ 4 B 50S ribosomal protein L3P 2238
45 4V88 40 BB, DB 60S ribosomal protein L3 4932
46 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
47 3OW2 4 B 50S ribosomal protein L3P 2238
48 4U4R 40 L3, l3 60S ribosomal protein L3 4932
49 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
50 1QVG 5 B 50S ribosomal protein L3P 2238
51 3CME 2 B 50S ribosomal protein L3P 2238
52 2QEX 4 B 50S ribosomal protein L3P 2238
53 4U3U 40 L3, l3 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 3I55 3 B 50S ribosomal protein L3P 2238
74 5I4L 40 L3, l3 60S ribosomal protein L3 4932
75 4U51 40 L3, l3 60S ribosomal protein L3 4932
76 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
77 4U53 40 L3, l3 60S ribosomal protein L3 4932
78 1Q86 5 D 50S ribosomal protein L3P 2238
79 4U50 40 L3, l3 60S ribosomal protein L3 4932
80 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
81 3G4S 3 B 50S ribosomal protein L3P 2238
82 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
83 4U56 40 L3, l3 60S ribosomal protein L3 4932
84 2QA4 4 B 50S ribosomal protein L3P 2238
85 1Q7Y 5 D 50S ribosomal protein L3P 2238
86 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
87 4U4O 40 L3, l3 60S ribosomal protein L3 4932
88 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
89 5FCI 40 L3, l3 60S ribosomal protein L3 4932
90 5DC3 40 L3, l3 60S ribosomal protein L3 4932
91 4V7R 34 BC, DC 60S ribosomal protein L3 4932
92 4V4P 5 AE 50S ribosomal protein L3 274
93 4V4R 29 BE 50S ribosomal protein L3 274
94 4V4S 29 BE 50S ribosomal protein L3 274
95 4V4T 28 BE 50S ribosomal protein L3 274
96 5IT7 5 BB 60S ribosomal protein L3 28985
97 3JCT 2 B 60S ribosomal protein L3 4932
98 3JCS 10 B ribosomal protein L3 5661
99 5GAK 17 F 60S ribosomal protein L3 4932
100 5FL8 2 B 60S ribosomal protein L3 4932
101 5APN 5 B 60S ribosomal protein L3 4932
102 5APO 5 B 60S ribosomal protein L3 4932
103 3JBN 70 AE 60S ribosomal protein uL3 5833
104 3JBO 70 AE 60S ribosomal protein uL3 5833
105 3JBP 70 AE 60S ribosomal protein uL3 5833
106 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
107 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
108 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
109 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
110 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
111 3JAG 2 B uL3 9986
112 3JAH 2 B uL3 9986
113 3JAI 2 B uL3 9986
114 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
115 5AJ0 4 AB 60S ribosomal protein L3 9606
116 3J92 2 B uL3 9986
117 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
118 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
119 4V3P 80 LC Ribosomal protein L3 4565
120 3J7O 5 B Ribosomal protein uL3 9823
121 3J7P 5 B Ribosomal protein uL3 9823
122 3J7Q 5 B Ribosomal protein uL3 9823
123 3J7R 5 B Ribosomal protein uL3 9823
124 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
125 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
126 3J79 5 E 60S ribosomal protein uL3 5833
127 3J77 3 L3 60S ribosomal protein L3 4932
128 3J78 3 L3 60S ribosomal protein L3 4932
129 3J6X 6 L3 60S ribosomal protein L3 4932
130 3J6Y 6 L3 60S ribosomal protein L3 4932
131 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
132 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
133 4V7F 6 C 60S ribosomal protein L3 4932
134 4V7E 71 CB 60S ribosomal protein L3 4565
135 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
136 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
137 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
138 4V6W 63 CB 60S ribosomal protein L3 7227
139 4V6X 63 CB 60S ribosomal protein L3 9606
140 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
141 4V6U 33 BC 50S ribosomal protein L3P 2261
142 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
143 4ADX 12 B RPL3 145262
144 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
145 4V7H 27 BC 60S ribosomal protein L3 5541
146 4V5Z 54 Bb 60S Ribosomal protein L3 9612
147 4V4B 22 BC 60S ribosomal protein L3 4932
148 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
149 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274