Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 17 44 804
95 % 36 68 636
90 % 36 68 663
70 % 36 68 705
50 % 36 174 198
40 % 36 174 217
30 % 44 506 29
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 58062
95 % 1 1 40478
90 % 1 1 38552
70 % 36 68 697
50 % 36 170 205
40 % 36 170 227
30 % 36 170 233
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 405
95 % 36 74 566
90 % 36 74 594
70 % 36 74 625
50 % 36 74 673
40 % 36 74 712
30 % 43 488 35
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 403
95 % 36 74 564
90 % 36 74 592
70 % 36 74 622
50 % 36 76 651
40 % 36 76 693
30 % 36 79 665
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 452
95 % 36 68 637
90 % 36 68 665
70 % 36 68 707
50 % 36 70 729
40 % 36 70 766
30 % 36 70 766
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2129
95 % 36 68 635
90 % 36 68 661
70 % 36 68 703
50 % 36 68 755
40 % 36 72 738
30 % 36 72 737
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 454
95 % 36 68 640
90 % 36 68 667
70 % 36 68 711
50 % 36 70 730
40 % 36 70 767
30 % 36 71 750
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 67 463
95 % 36 68 633
90 % 36 68 659
70 % 36 68 700
50 % 36 68 752
40 % 36 68 787
30 % 36 173 226
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 411
95 % 36 74 571
90 % 36 74 598
70 % 36 74 631
50 % 36 76 654
40 % 36 78 670
30 % 43 397 57
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 409
95 % 36 74 569
90 % 36 74 597
70 % 36 74 630
50 % 36 178 192
40 % 36 178 208
30 % 36 178 221
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 70 434
95 % 34 70 615
90 % 34 70 641
70 % 34 70 681
50 % 34 70 731
40 % 34 70 769
30 % 34 70 768
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 413
95 % 36 74 572
90 % 36 74 599
70 % 36 74 632
50 % 36 74 678
40 % 36 74 715
30 % 36 74 716
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 450
95 % 36 68 634
90 % 36 68 660
70 % 36 68 701
50 % 36 68 753
40 % 36 70 763
30 % 36 71 747
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 456
95 % 36 68 642
90 % 36 68 669
70 % 36 68 713
50 % 36 68 760
40 % 36 68 792
30 % 36 68 789
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 61371
95 % 3 5 13716
90 % 3 5 13469
70 % 3 5 12638
50 % 3 5 11301
40 % 3 5 10255
30 % 3 5 8904
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 67630
95 % 1 1 46877
90 % 1 1 44596
70 % 3 21 2800
50 % 7 30 1872
40 % 7 127 292
30 % 26 150 263
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 457
95 % 36 68 643
90 % 36 68 670
70 % 36 68 716
50 % 36 69 739
40 % 36 69 780
30 % 36 69 779
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 69026
95 % 36 68 644
90 % 36 68 671
70 % 36 68 717
50 % 36 171 201
40 % 36 171 224
30 % 36 171 231
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 455
95 % 36 68 641
90 % 36 68 668
70 % 36 68 712
50 % 36 68 759
40 % 36 68 791
30 % 36 167 238
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 449
95 % 36 68 632
90 % 36 68 658
70 % 36 68 699
50 % 36 68 751
40 % 36 172 221
30 % 44 497 32
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2113
95 % 36 68 630
90 % 36 68 656
70 % 36 68 696
50 % 36 169 204
40 % 36 171 223
30 % 36 171 230
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 51400
95 % 36 74 555
90 % 36 74 585
70 % 36 74 617
50 % 36 74 667
40 % 36 178 205
30 % 36 178 218
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 9669
95 % 36 74 559
90 % 36 74 589
70 % 36 74 621
50 % 36 74 669
40 % 36 76 691
30 % 37 78 674
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 404
95 % 36 74 565
90 % 36 74 593
70 % 36 74 623
50 % 36 74 671
40 % 37 178 207
30 % 37 178 220
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2140
95 % 3 21 2771
90 % 36 68 664
70 % 36 68 706
50 % 51 105 311
40 % 58 120 281
30 % 58 122 279
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 60293
95 % 1 1 41719
90 % 1 7 9766
70 % 3 27 2080
50 % 36 74 672
40 % 36 79 658
30 % 36 79 668
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 406
95 % 36 74 567
90 % 36 74 595
70 % 36 74 628
50 % 36 74 677
40 % 37 77 683
30 % 37 78 677

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CCJ 2 B 50S ribosomal protein L3P 2238
20 3CC7 2 B 50S ribosomal protein L3P 2238
21 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
22 3CCE 2 B 50S ribosomal protein L3P 2238
23 3G6E 3 B 50S ribosomal protein L3P 2238
24 3CPW 4 B 50S ribosomal protein L3P 2238
25 3CCU 2 B 50S ribosomal protein L3P 2238
26 1VQ6 6 B 50S ribosomal protein L3P 2238
27 1M90 5 D RIBOSOMAL PROTEIN L3 2238
28 3CCL 2 B 50S ribosomal protein L3P 2238
29 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
30 1YJ9 4 B 50S ribosomal protein L3P 2238
31 3CD6 2 B 50S ribosomal protein L3P 2238
32 3CCV 2 B 50S ribosomal protein L3P 2238
33 3CC4 2 B 50S ribosomal protein L3P 2238
34 2OTL 4 B 50S ribosomal protein L3P 2238
35 3G71 3 B 50S ribosomal protein L3P 2238
36 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
37 1VQ4 5 B 50S ribosomal protein L3P 2238
38 1YJN 4 B 50S ribosomal protein L3P 2238
39 3CMA 2 B 50S ribosomal protein L3P 2238
40 3CCS 2 B 50S ribosomal protein L3P 2238
41 3CCQ 2 B 50S ribosomal protein L3P 2238
42 3I56 2 B 50S ribosomal protein L3P 2238
43 3CCR 2 B 50S ribosomal protein L3P 2238
44 2OTJ 4 B 50S ribosomal protein L3P 2238
45 4V88 40 BB, DB 60S ribosomal protein L3 4932
46 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
47 3OW2 4 B 50S ribosomal protein L3P 2238
48 4U4R 40 L3, l3 60S ribosomal protein L3 4932
49 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
50 1QVG 5 B 50S ribosomal protein L3P 2238
51 3CME 2 B 50S ribosomal protein L3P 2238
52 2QEX 4 B 50S ribosomal protein L3P 2238
53 4U3U 40 L3, l3 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 4U53 40 L3, l3 60S ribosomal protein L3 4932
79 1Q86 5 D 50S ribosomal protein L3P 2238
80 4U50 40 L3, l3 60S ribosomal protein L3 4932
81 5LYB 40 L3, l3 60S ribosomal protein L3 4932
82 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
83 3G4S 3 B 50S ribosomal protein L3P 2238
84 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
85 4U56 40 L3, l3 60S ribosomal protein L3 4932
86 2QA4 4 B 50S ribosomal protein L3P 2238
87 5TGA 40 L3, l3 60S ribosomal protein L3 4932
88 1Q7Y 5 D 50S ribosomal protein L3P 2238
89 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
90 4U4O 40 L3, l3 60S ribosomal protein L3 4932
91 5DGV 40 L3, l3 60S ribosomal protein L3 4932
92 5DGE 40 L3, l3 60S ribosomal protein L3 4932
93 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
94 5FCI 40 L3, l3 60S ribosomal protein L3 4932
95 5DC3 40 L3, l3 60S ribosomal protein L3 4932
96 5DGF 40 L3, l3 60S ribosomal protein L3 4932
97 5TGM 40 L3, l3 60S ribosomal protein L3 4932
98 4V7R 34 BC, DC 60S ribosomal protein L3 4932
99 4V4P 5 AE 50S ribosomal protein L3 274
100 4V4R 29 BE 50S ribosomal protein L3 274
101 4V4S 29 BE 50S ribosomal protein L3 274
102 4V4T 28 BE 50S ribosomal protein L3 274
103 5MC6 67 BA 60S ribosomal protein L3 4932
104 5H4P 5 B 60S ribosomal protein L3 4932
105 5M1J 42 B5 60S ribosomal protein L3 4932
106 5LZS 2 B Uncharacterized protein 9986
107 5LZT 2 B uL3 9986
108 5LZU 2 B uL3 9986
109 5LZV 2 B uL3 9986
110 5LZW 2 B uL3 9986
111 5LZX 2 B Ul3 9986
112 5LZY 2 B uL3 9986
113 5LZZ 2 B uL3 9986
114 5T62 6 E 60S ribosomal protein L3 4932
115 5T6R 5 E 60S ribosomal protein L3 4932
116 5T5H 29 f Ribosomal protein L13 5693
117 5T2A 30 d uL3 5661
118 5T2C 4 E 60S ribosomal protein L3 9606
119 5JUO 7 G uL3 (yeast L3) 4932
120 5JUP 7 G uL3 (yeast L3) 4932
121 5JUS 7 G uL3 (yeast L3) 4932
122 5JUT 7 G uL3 (yeast L3) 4932
123 5JUU 7 G uL3 (yeast L3) 4932
124 5JCS 3 B 60S ribosomal protein L3 4932
125 5IT7 5 BB 60S ribosomal protein L3 28985
126 3JCT 2 B 60S ribosomal protein L3 4932
127 3JCS 10 B ribosomal protein L3 5661
128 5GAK 17 F 60S ribosomal protein L3 4932
129 5FL8 2 B 60S ribosomal protein L3 4932
130 5APN 5 B 60S ribosomal protein L3 4932
131 5APO 5 B 60S ribosomal protein L3 4932
132 3JBN 70 AE 60S ribosomal protein uL3 5833
133 3JBO 70 AE 60S ribosomal protein uL3 5833
134 3JBP 70 AE 60S ribosomal protein uL3 5833
135 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
136 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
137 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
138 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
139 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
140 3JAG 2 B uL3 9986
141 3JAH 2 B uL3 9986
142 3JAI 2 B uL3 9986
143 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
144 5AJ0 4 AB 60S ribosomal protein L3 9606
145 3J92 2 B uL3 9986
146 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
147 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
148 4V3P 80 LC Ribosomal protein L3 4565
149 3J7O 5 B Ribosomal protein uL3 9823
150 3J7P 5 B Ribosomal protein uL3 9823
151 3J7Q 5 B Ribosomal protein uL3 9823
152 3J7R 5 B Ribosomal protein uL3 9823
153 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
154 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
155 3J79 5 E 60S ribosomal protein uL3 5833
156 3J77 3 L3 60S ribosomal protein L3 4932
157 3J78 3 L3 60S ribosomal protein L3 4932
158 3J6X 6 L3 60S ribosomal protein L3 4932
159 3J6Y 6 L3 60S ribosomal protein L3 4932
160 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
161 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
162 4V7F 6 C 60S ribosomal protein L3 4932
163 4V7E 71 CB 60S ribosomal protein L3 4565
164 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
165 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
166 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
167 4V6W 63 CB 60S ribosomal protein L3 7227
168 4V6X 63 CB 60S ribosomal protein L3 9606
169 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
170 4V6U 33 BC 50S ribosomal protein L3P 2261
171 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
172 4ADX 12 B RPL3 145262
173 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
174 4V7H 27 BC 60S ribosomal protein L3 5541
175 4V5Z 54 Bb 60S Ribosomal protein L3 9612
176 4V4B 22 BC 60S ribosomal protein L3 4932
177 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
178 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274