Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 915
95 % 35 68 732 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 762
70 % 35 68 814
50 % 35 197 200
40 % 45 580 20
30 % 45 580 35
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63891
95 % 1 1 44514
90 % 1 1 42220
70 % 35 68 805
50 % 35 196 202
40 % 35 196 215
30 % 35 196 226
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 468
95 % 35 74 646 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 672
70 % 35 74 723
50 % 35 74 775
40 % 35 74 814
30 % 44 555 41
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 466
95 % 35 74 644 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 670
70 % 35 74 719
50 % 35 76 752
40 % 35 76 788
30 % 35 79 747
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 541
95 % 35 68 734 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 765
70 % 35 68 817
50 % 35 70 825
40 % 35 70 865
30 % 35 70 850
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2412
95 % 35 68 731 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 761
70 % 35 68 813
50 % 35 68 856
40 % 35 72 835
30 % 35 72 828
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 543
95 % 35 68 736 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 767
70 % 35 68 819
50 % 35 70 826
40 % 35 70 866
30 % 35 71 840
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 554
95 % 35 68 729 Flexibility: No
Max RMSD: 5.1, Avg RMSD: 0.4
PDBFlex
90 % 35 68 759
70 % 35 68 810
50 % 35 68 853
40 % 35 68 893
30 % 35 199 223
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 473
95 % 35 74 650 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 677
70 % 35 74 726
50 % 35 77 745
40 % 35 79 751
30 % 44 446 65
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 472
95 % 35 74 649 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 676
70 % 35 74 725
50 % 35 203 194
40 % 35 204 207
30 % 35 204 217
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 509
95 % 33 70 700 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 727
70 % 33 70 776
50 % 33 70 828
40 % 33 70 868
30 % 33 70 853
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 474
95 % 35 74 651 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 678
70 % 35 74 727
50 % 35 74 779
40 % 44 406 53
30 % 44 432 67
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 539
95 % 35 68 730 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 760
70 % 35 68 811
50 % 35 68 854
40 % 35 70 864
30 % 35 71 837
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 545
95 % 35 68 738 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 769
70 % 35 68 821
50 % 35 68 861
40 % 35 68 896
30 % 35 68 878
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 67463
95 % 3 5 15238 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 14956
70 % 3 5 14022
50 % 3 5 12437
40 % 3 5 11264
30 % 3 5 9782
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 74078
95 % 1 1 51292
90 % 1 1 48604
70 % 3 21 3109
50 % 7 30 2090
40 % 7 146 270
30 % 26 169 249
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 546
95 % 35 68 739 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 770
70 % 35 68 822
50 % 35 69 840
40 % 35 69 881
30 % 35 69 865
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 75558
95 % 35 68 740 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 771
70 % 35 68 823
50 % 35 189 203
40 % 35 189 221
30 % 35 189 232
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 544
95 % 35 68 737 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.4
PDBFlex
90 % 35 68 768
70 % 35 68 820
50 % 35 68 860
40 % 35 68 895
30 % 35 184 236
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 538
95 % 35 68 728 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 757
70 % 35 68 808
50 % 35 68 852
40 % 35 194 217
30 % 45 570 38
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2394
95 % 35 68 725 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 754
70 % 35 68 803
50 % 35 187 205
40 % 44 557 22
30 % 44 557 39
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 56633
95 % 35 74 635 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 664
70 % 35 74 714
50 % 35 74 767
40 % 35 202 209
30 % 35 202 218
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10819
95 % 35 74 638 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 667
70 % 35 74 716
50 % 35 74 769
40 % 35 76 783
30 % 36 78 760
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 467
95 % 35 74 645 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 671
70 % 35 74 720
50 % 35 74 772
40 % 36 196 214
30 % 36 196 224
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2424
95 % 3 21 3091 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 764
70 % 35 68 816
50 % 51 107 387
40 % 58 128 284
30 % 58 130 291
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 66283
95 % 1 1 45845
90 % 1 7 10883
70 % 3 27 2339
50 % 35 74 773
40 % 35 79 750
30 % 35 79 749
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 470
95 % 35 74 647
90 % 35 74 673
70 % 35 74 724
50 % 35 74 778
40 % 36 77 775
30 % 36 78 766

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 5ON6 5 CE, k 60S ribosomal protein L3 4932
81 1Q86 5 D 50S ribosomal protein L3P 2238
82 4U50 40 L3, l3 60S ribosomal protein L3 4932
83 5NDV 5 L3, l3 60S ribosomal protein L3 4932
84 5LYB 40 L3, l3 60S ribosomal protein L3 4932
85 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
86 3G4S 3 B 50S ribosomal protein L3P 2238
87 3CCJ 2 B 50S ribosomal protein L3P 2238
88 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
89 4U56 40 L3, l3 60S ribosomal protein L3 4932
90 2QA4 4 B 50S ribosomal protein L3P 2238
91 5TGA 40 L3, l3 60S ribosomal protein L3 4932
92 5MEI 5 CE, k 60S ribosomal protein L3 4932
93 1Q7Y 5 D 50S ribosomal protein L3P 2238
94 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
95 4U4O 40 L3, l3 60S ribosomal protein L3 4932
96 5DGV 40 L3, l3 60S ribosomal protein L3 4932
97 5DGE 40 L3, l3 60S ribosomal protein L3 4932
98 5NDW 28 L3, l3 60S ribosomal protein L3 4932
99 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
100 5NDG 40 L3, l3 60S ribosomal protein L3 4932
101 5FCI 40 L3, l3 60S ribosomal protein L3 4932
102 5DC3 40 L3, l3 60S ribosomal protein L3 4932
103 5DGF 40 L3, l3 60S ribosomal protein L3 4932
104 5TGM 40 L3, l3 60S ribosomal protein L3 4932
105 4V7R 34 BC, DC 60S ribosomal protein L3 4932
106 4V4P 5 AE 50S ribosomal protein L3 274
107 4V4R 29 BE 50S ribosomal protein L3 274
108 4V4S 29 BE 50S ribosomal protein L3 274
109 4V4T 28 BE 50S ribosomal protein L3 274
110 6FTG 2 B uL3 9986
111 6FTI 2 B uL3 9986
112 6FTJ 2 B uL3 9986
113 6FT6 3 B 60S ribosomal protein L3 4932
114 6FRK 10 B Ribosomal protein uL3 9986
115 5Z3G 6 F 60S ribosomal protein L3 4932
116 6C0F 5 B 60S ribosomal protein L3 4932
117 6EM1 16 B 60S ribosomal protein L3 4932
118 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
119 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
120 6ELZ 28 B 60S ribosomal protein L3 4932
121 6EK0 5 LB 60S ribosomal protein L3 9606
122 6AZ3 2 B ribosomal protein uL3 5661
123 5XY3 5 B Uncharacterized protein 5722
124 5XXB 5 B Ribosomal protein uL3 5811
125 5UMD 5 E 60S ribosomal protein L3 5833
126 5MC6 67 BA 60S ribosomal protein L3 4932
127 5H4P 5 B 60S ribosomal protein L3 4932
128 5M1J 42 B5 60S ribosomal protein L3 4932
129 5LZS 2 B Uncharacterized protein 9986
130 5LZT 2 B uL3 9986
131 5LZU 2 B uL3 9986
132 5LZV 2 B uL3 9986
133 5LZW 2 B uL3 9986
134 5LZX 2 B Ul3 9986
135 5LZY 2 B uL3 9986
136 5LZZ 2 B uL3 9986
137 5T62 6 E 60S ribosomal protein L3 4932
138 5T6R 5 E 60S ribosomal protein L3 4932
139 5T5H 29 f Ribosomal protein L13 5693
140 5T2A 30 d uL3 5661
141 5T2C 4 E 60S ribosomal protein L3 9606
142 5LKS 5 LB 60S ribosomal protein L3 9606
143 5JUO 7 G uL3 (yeast L3) 4932
144 5JUP 7 G uL3 (yeast L3) 4932
145 5JUS 7 G uL3 (yeast L3) 4932
146 5JUT 7 G uL3 (yeast L3) 4932
147 5JUU 7 G uL3 (yeast L3) 4932
148 5JCS 3 B 60S ribosomal protein L3 4932
149 5IT7 5 BB 60S ribosomal protein L3 28985
150 3JCT 2 B 60S ribosomal protein L3 4932
151 3JCS 10 B ribosomal protein L3 5661
152 5GAK 17 F 60S ribosomal protein L3 4932
153 5FL8 2 B 60S ribosomal protein L3 4932
154 5APN 5 B 60S ribosomal protein L3 4932
155 5APO 5 B 60S ribosomal protein L3 4932
156 3JBN 70 AE 60S ribosomal protein uL3 5833
157 3JBO 70 AE 60S ribosomal protein uL3 5833
158 3JBP 70 AE 60S ribosomal protein uL3 5833
159 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
160 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
161 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
162 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
163 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
164 3JAG 2 B uL3 9986
165 3JAH 2 B uL3 9986
166 3JAI 2 B uL3 9986
167 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
168 5AJ0 4 AB 60S ribosomal protein L3 9606
169 3J92 2 B uL3 9986
170 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
171 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
172 4V3P 80 LC Ribosomal protein L3 4565
173 3J7O 5 B Ribosomal protein uL3 9823
174 3J7P 5 B Ribosomal protein uL3 9823
175 3J7Q 5 B Ribosomal protein uL3 9823
176 3J7R 5 B Ribosomal protein uL3 9823
177 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
178 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
179 3J79 5 E 60S ribosomal protein uL3 5833
180 3J77 3 L3 60S ribosomal protein L3 4932
181 3J78 3 L3 60S ribosomal protein L3 4932
182 3J6X 6 L3 60S ribosomal protein L3 4932
183 3J6Y 6 L3 60S ribosomal protein L3 4932
184 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
185 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
186 4V7F 6 C 60S ribosomal protein L3 4932
187 4V7E 71 CB 60S ribosomal protein L3 4565
188 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
189 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
190 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
191 4V6W 63 CB 60S ribosomal protein L3 7227
192 4V6X 63 CB 60S ribosomal protein L3 9606
193 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
194 4V6U 33 BC 50S ribosomal protein L3P 2261
195 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
196 4ADX 12 B RPL3 145262
197 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
198 4V7H 27 BC 60S ribosomal protein L3 5541
199 4V5Z 54 Bb 60S Ribosomal protein L3 9612
200 4V4B 22 BC 60S ribosomal protein L3 4932
201 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
202 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274