Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 17 44 749
95 % 36 68 531
90 % 36 68 559
70 % 36 68 612
50 % 36 144 215
40 % 36 144 245
30 % 44 431 32
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 54678
95 % 1 1 38174
90 % 1 1 36367
70 % 36 68 606
50 % 36 139 228
40 % 36 139 259
30 % 36 139 268
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 312
95 % 36 74 465
90 % 36 74 492
70 % 36 74 537
50 % 36 74 626
40 % 36 74 670
30 % 43 420 40
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 310
95 % 36 74 463
90 % 36 74 490
70 % 36 74 534
50 % 36 76 604
40 % 36 76 647
30 % 36 78 627
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 357
95 % 36 68 533
90 % 36 68 562
70 % 36 68 614
50 % 36 70 677
40 % 36 70 719
30 % 36 70 724
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1948
95 % 36 68 530
90 % 36 68 558
70 % 36 68 611
50 % 36 68 705
40 % 36 70 716
30 % 36 71 707
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 358
95 % 36 68 534
90 % 36 68 564
70 % 36 68 616
50 % 36 70 679
40 % 36 70 721
30 % 36 71 710
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 67 367
95 % 36 68 528
90 % 36 68 556
70 % 36 68 609
50 % 36 68 702
40 % 36 68 738
30 % 36 143 257
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 317
95 % 36 74 471
90 % 36 74 499
70 % 36 74 544
50 % 36 76 606
40 % 36 78 622
30 % 43 359 54
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 315
95 % 36 74 469
90 % 36 74 497
70 % 36 74 542
50 % 36 148 213
40 % 36 148 239
30 % 36 148 251
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 70 344
95 % 34 70 510
90 % 34 70 536
70 % 34 70 588
50 % 34 70 680
40 % 34 70 722
30 % 34 70 725
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 318
95 % 36 74 472
90 % 36 74 500
70 % 36 74 545
50 % 36 74 633
40 % 36 74 675
30 % 36 74 672
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 355
95 % 36 68 529
90 % 36 68 557
70 % 36 68 610
50 % 36 68 703
40 % 36 70 715
30 % 36 71 706
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 360
95 % 36 68 536
90 % 36 68 566
70 % 36 68 618
50 % 36 68 707
40 % 36 68 741
30 % 36 68 744
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 57836
95 % 3 5 12901
90 % 3 5 12660
70 % 3 5 11920
50 % 3 5 10681
40 % 3 5 9738
30 % 3 5 8476
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63850
95 % 1 1 44310
90 % 1 1 42217
70 % 3 21 2593
50 % 7 30 1737
40 % 7 97 360
30 % 26 120 314
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 362
95 % 36 68 538
90 % 36 68 568
70 % 36 68 620
50 % 36 69 693
40 % 36 69 732
30 % 36 69 739
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 65195
95 % 36 68 540
90 % 36 68 569
70 % 36 68 621
50 % 36 141 222
40 % 36 141 255
30 % 36 141 264
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 359
95 % 36 68 535
90 % 36 68 565
70 % 36 68 617
50 % 36 68 706
40 % 36 68 740
30 % 36 138 270
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 354
95 % 36 68 527
90 % 36 68 555
70 % 36 68 608
50 % 36 68 701
40 % 36 143 247
30 % 44 426 37
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1924
95 % 36 68 525
90 % 36 68 553
70 % 36 68 605
50 % 36 139 227
40 % 36 141 254
30 % 36 141 262
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 48358
95 % 36 74 455
90 % 36 74 483
70 % 36 74 529
50 % 36 74 618
40 % 36 148 237
30 % 36 148 249
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 8996
95 % 36 74 458
90 % 36 74 486
70 % 36 74 532
50 % 36 74 621
40 % 36 76 646
30 % 36 77 635
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 311
95 % 36 74 464
90 % 36 74 491
70 % 36 74 535
50 % 36 74 624
40 % 37 148 238
30 % 37 148 250
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 1958
95 % 3 21 2541
90 % 36 68 561
70 % 36 68 613
50 % 51 96 348
40 % 58 110 309
30 % 58 112 323
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 56812
95 % 1 1 39361
90 % 1 7 9158
70 % 3 27 1900
50 % 36 74 625
40 % 36 79 609
30 % 36 79 616
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 313
95 % 36 74 466
90 % 36 74 494
70 % 36 74 539
50 % 36 74 629
40 % 37 77 633
30 % 37 78 630

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CCJ 2 B 50S ribosomal protein L3P 2238
20 3CC7 2 B 50S ribosomal protein L3P 2238
21 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
22 3CCE 2 B 50S ribosomal protein L3P 2238
23 3G6E 3 B 50S ribosomal protein L3P 2238
24 3CPW 4 B 50S ribosomal protein L3P 2238
25 3CCU 2 B 50S ribosomal protein L3P 2238
26 1VQ6 6 B 50S ribosomal protein L3P 2238
27 1M90 5 D RIBOSOMAL PROTEIN L3 2238
28 3CCL 2 B 50S ribosomal protein L3P 2238
29 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
30 1YJ9 4 B 50S ribosomal protein L3P 2238
31 3CD6 2 B 50S ribosomal protein L3P 2238
32 3CCV 2 B 50S ribosomal protein L3P 2238
33 3CC4 2 B 50S ribosomal protein L3P 2238
34 2OTL 4 B 50S ribosomal protein L3P 2238
35 3G71 3 B 50S ribosomal protein L3P 2238
36 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
37 1VQ4 5 B 50S ribosomal protein L3P 2238
38 1YJN 4 B 50S ribosomal protein L3P 2238
39 3CMA 2 B 50S ribosomal protein L3P 2238
40 3CCS 2 B 50S ribosomal protein L3P 2238
41 3CCQ 2 B 50S ribosomal protein L3P 2238
42 3I56 2 B 50S ribosomal protein L3P 2238
43 3CCR 2 B 50S ribosomal protein L3P 2238
44 2OTJ 4 B 50S ribosomal protein L3P 2238
45 4V88 40 BB, DB 60S ribosomal protein L3 4932
46 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
47 3OW2 4 B 50S ribosomal protein L3P 2238
48 4U4R 40 L3, l3 60S ribosomal protein L3 4932
49 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
50 1QVG 5 B 50S ribosomal protein L3P 2238
51 3CME 2 B 50S ribosomal protein L3P 2238
52 2QEX 4 B 50S ribosomal protein L3P 2238
53 4U3U 40 L3, l3 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 3I55 3 B 50S ribosomal protein L3P 2238
74 5I4L 40 L3, l3 60S ribosomal protein L3 4932
75 4U51 40 L3, l3 60S ribosomal protein L3 4932
76 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
77 4U53 40 L3, l3 60S ribosomal protein L3 4932
78 1Q86 5 D 50S ribosomal protein L3P 2238
79 4U50 40 L3, l3 60S ribosomal protein L3 4932
80 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
81 3G4S 3 B 50S ribosomal protein L3P 2238
82 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
83 4U56 40 L3, l3 60S ribosomal protein L3 4932
84 2QA4 4 B 50S ribosomal protein L3P 2238
85 1Q7Y 5 D 50S ribosomal protein L3P 2238
86 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
87 4U4O 40 L3, l3 60S ribosomal protein L3 4932
88 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
89 5FCI 40 L3, l3 60S ribosomal protein L3 4932
90 5DC3 40 L3, l3 60S ribosomal protein L3 4932
91 4V7R 34 BC, DC 60S ribosomal protein L3 4932
92 4V4P 5 AE 50S ribosomal protein L3 274
93 4V4R 29 BE 50S ribosomal protein L3 274
94 4V4S 29 BE 50S ribosomal protein L3 274
95 4V4T 28 BE 50S ribosomal protein L3 274
96 5IT7 5 BB 60S ribosomal protein L3 28985
97 3JCT 2 B 60S ribosomal protein L3 4932
98 5GAK 17 F 60S ribosomal protein L3 4932
99 5FL8 2 B 60S ribosomal protein L3 4932
100 5APN 5 B 60S ribosomal protein L3 4932
101 5APO 5 B 60S ribosomal protein L3 4932
102 3JBN 70 AE 60S ribosomal protein uL3 5833
103 3JBO 70 AE 60S ribosomal protein uL3 5833
104 3JBP 70 AE 60S ribosomal protein uL3 5833
105 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
106 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
107 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
108 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
109 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
110 3JAG 2 B uL3 9986
111 3JAH 2 B uL3 9986
112 3JAI 2 B uL3 9986
113 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
114 5AJ0 4 AB 60S ribosomal protein L3 9606
115 3J92 2 B uL3 9986
116 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
117 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
118 4V3P 80 LC Ribosomal protein L3 4565
119 3J7O 5 B Ribosomal protein uL3 9823
120 3J7P 5 B Ribosomal protein uL3 9823
121 3J7Q 5 B Ribosomal protein uL3 9823
122 3J7R 5 B Ribosomal protein uL3 9823
123 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
124 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
125 3J79 5 E 60S ribosomal protein uL3 5833
126 3J77 3 L3 60S ribosomal protein L3 4932
127 3J78 3 L3 60S ribosomal protein L3 4932
128 3J6X 6 L3 60S ribosomal protein L3 4932
129 3J6Y 6 L3 60S ribosomal protein L3 4932
130 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
131 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
132 4V7F 6 C 60S ribosomal protein L3 4932
133 4V7E 71 CB 60S ribosomal protein L3 4565
134 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
135 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
136 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
137 4V6W 63 CB 60S ribosomal protein L3 7227
138 4V6X 63 CB 60S ribosomal protein L3 9606
139 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
140 4V6U 33 BC 50S ribosomal protein L3P 2261
141 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
142 4ADX 12 B RPL3 145262
143 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
144 4V7H 27 BC 60S ribosomal protein L3 5541
145 4V5Z 54 Bb 60S Ribosomal protein L3 9612
146 4V4B 22 BC 60S ribosomal protein L3 4932
147 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
148 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274