Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 641
95 % 35 68 781 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 812
70 % 35 68 862
50 % 35 215 204
40 % 45 647 23
30 % 45 647 40
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 50309
95 % 1 1 41664
90 % 1 1 39661
70 % 35 68 863
50 % 35 214 205
40 % 35 214 224
30 % 35 214 241
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 581
95 % 35 74 717 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 741
70 % 35 74 785
50 % 35 74 838
40 % 35 212 225
30 % 35 212 243
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 572
95 % 35 74 703 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 728
70 % 35 74 774
50 % 35 76 805
40 % 35 76 836
30 % 35 79 805
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 654
95 % 35 68 797 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 829
70 % 35 68 880
50 % 35 70 886
40 % 35 70 915
30 % 35 70 906
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2980
95 % 35 68 802 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 834
70 % 35 68 883
50 % 35 68 931
40 % 35 72 887
30 % 35 72 889
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 642
95 % 35 68 782 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 813
70 % 35 68 864
50 % 35 70 896
40 % 35 70 929
30 % 35 71 901
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 669
95 % 35 68 787 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 819
70 % 35 68 869
50 % 35 68 921
40 % 35 68 949
30 % 35 212 242
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 584
95 % 35 74 718 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 744
70 % 35 74 790
50 % 35 77 796
40 % 44 496 40
30 % 44 496 60
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 577
95 % 35 74 710 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 734
70 % 35 74 779
50 % 35 221 203
40 % 35 222 218
30 % 35 222 235
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 615
95 % 33 70 755 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 787
70 % 33 70 829
50 % 33 70 887
40 % 33 70 916
30 % 33 70 907
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 578
95 % 35 74 711 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 735
70 % 35 74 780
50 % 35 74 830
40 % 44 451 51
30 % 44 477 65
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 647
95 % 35 68 788 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 820
70 % 35 68 870
50 % 35 68 922
40 % 35 70 919
30 % 35 71 900
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 643
95 % 35 68 798 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 830
70 % 35 68 881
50 % 35 68 929
40 % 35 68 956
30 % 35 70 913
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 60829
95 % 3 5 15894 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 15549
70 % 3 5 14477
50 % 3 5 12780
40 % 3 5 11446
30 % 3 5 9741
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2887
95 % 3 21 3227 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 3 21 3288
70 % 3 21 3234
50 % 7 30 2201
40 % 7 164 283
30 % 9 168 289
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 655
95 % 35 68 783 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 814
70 % 35 68 865
50 % 35 69 899
40 % 35 69 933
30 % 35 69 918
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 57257
95 % 35 68 791 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 823
70 % 35 68 874
50 % 35 207 209
40 % 35 207 229
30 % 35 207 246
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 640
95 % 35 68 780 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 811
70 % 35 68 861
50 % 35 68 915
40 % 35 202 234
30 % 35 202 250
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 652
95 % 35 68 795 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 827
70 % 35 68 858
50 % 35 68 927
40 % 35 212 226
30 % 45 636 41
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 6 25 2333
95 % 35 68 796 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 828
70 % 35 68 878
50 % 35 205 210
40 % 35 205 230
30 % 35 205 248
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 63257
95 % 35 74 715 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 739
70 % 35 74 783
50 % 35 74 837
40 % 35 220 219
30 % 35 220 237
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 22 51 926
95 % 35 74 702 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 727
70 % 35 74 773
50 % 35 74 823
40 % 35 76 835
30 % 36 78 815
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 580
95 % 35 74 713 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 738
70 % 35 74 782
50 % 35 74 835
40 % 36 214 221
30 % 36 214 239
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2902
95 % 3 21 3240 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 810
70 % 35 68 859
50 % 51 108 412
40 % 58 133 331
30 % 72 292 155
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63255
95 % 1 1 51510
90 % 1 7 11754
70 % 3 27 2526
50 % 35 74 824
40 % 35 79 801
30 % 35 79 804
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 576
95 % 35 74 708 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 724
70 % 35 74 770
50 % 35 74 827
40 % 36 78 823
30 % 36 78 819

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 5OBM 5 L3, l3 60S ribosomal protein L3 4932
79 4U53 40 L3, l3 60S ribosomal protein L3 4932
80 5ON6 5 CE, k 60S ribosomal protein L3 4932
81 1Q86 5 D 50S ribosomal protein L3P 2238
82 4U50 40 L3, l3 60S ribosomal protein L3 4932
83 5NDV 5 L3, l3 60S ribosomal protein L3 4932
84 5LYB 40 L3, l3 60S ribosomal protein L3 4932
85 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
86 3G4S 3 B 50S ribosomal protein L3P 2238
87 3CCJ 2 B 50S ribosomal protein L3P 2238
88 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
89 4U56 40 L3, l3 60S ribosomal protein L3 4932
90 2QA4 4 B 50S ribosomal protein L3P 2238
91 5TGA 40 L3, l3 60S ribosomal protein L3 4932
92 5MEI 5 CE, k 60S ribosomal protein L3 4932
93 1Q7Y 5 D 50S ribosomal protein L3P 2238
94 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
95 4U4O 40 L3, l3 60S ribosomal protein L3 4932
96 5DGV 40 L3, l3 60S ribosomal protein L3 4932
97 5DGE 40 L3, l3 60S ribosomal protein L3 4932
98 5NDW 28 L3, l3 60S ribosomal protein L3 4932
99 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
100 5NDG 40 L3, l3 60S ribosomal protein L3 4932
101 5FCI 40 L3, l3 60S ribosomal protein L3 4932
102 5DC3 40 L3, l3 60S ribosomal protein L3 4932
103 5DGF 40 L3, l3 60S ribosomal protein L3 4932
104 5TGM 40 L3, l3 60S ribosomal protein L3 4932
105 4V7R 34 BC, DC 60S ribosomal protein L3 4932
106 4V4P 5 AE 50S ribosomal protein L3 274
107 4V4R 29 BE 50S ribosomal protein L3 274
108 4V4S 29 BE 50S ribosomal protein L3 274
109 4V4T 28 BE 50S ribosomal protein L3 274
110 6I7O 5 BA, YA 60S ribosomal protein L3 4932
111 6MTB 8 B 60S ribosomal protein L3 9986
112 6MTC 6 B 60S ribosomal protein L3 9986
113 6MTD 5 B uL3 9986
114 6MTE 5 B uL3 9986
115 6HD7 9 F 60S ribosomal protein L3 4932
116 6HCQ 39 B3 uL3 9986
117 6HCJ 39 B3 uL3 9986
118 6HCM 41 B3 uL3 9986
119 6HCF 41 B3 uL3 9986
120 6GZ3 42 AB ribosomal protein uL3 9986
121 6GZ4 3 AB ribosomal protein uL3 9986
122 6GZ5 42 AB ribosomal protein uL3 9986
123 6GQV 7 B 60S ribosomal protein L3 4932
124 6GQ1 7 B 60S ribosomal protein L3 4932
125 6GQB 7 B 60S ribosomal protein L3 4932
126 6D9J 2 B uL3 9986
127 6D90 2 B uL3 9986
128 6FTG 2 B uL3 9986
129 6FTI 2 B uL3 9986
130 6FTJ 2 B uL3 9986
131 6FT6 3 B 60S ribosomal protein L3 4932
132 6FRK 10 B Ribosomal protein uL3 9986
133 5Z3G 6 F 60S ribosomal protein L3 4932
134 6C0F 5 B 60S ribosomal protein L3 4932
135 6EM1 16 B 60S ribosomal protein L3 4932
136 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
137 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
138 6ELZ 28 B 60S ribosomal protein L3 4932
139 6EK0 5 LB 60S ribosomal protein L3 9606
140 6AZ3 2 B ribosomal protein uL3 5661
141 5XY3 5 B Uncharacterized protein 5722
142 5XXB 5 B Ribosomal protein uL3 5811
143 5UMD 5 E 60S ribosomal protein L3 5833
144 5MC6 67 BA 60S ribosomal protein L3 4932
145 5H4P 5 B 60S ribosomal protein L3 4932
146 5M1J 42 B5 60S ribosomal protein L3 4932
147 5LZS 2 B uL3 9986
148 5LZT 2 B uL3 9986
149 5LZU 2 B uL3 9986
150 5LZV 2 B uL3 9986
151 5LZW 2 B uL3 9986
152 5LZX 2 B Ul3 9986
153 5LZY 2 B uL3 9986
154 5LZZ 2 B uL3 9986
155 5T62 6 E 60S ribosomal protein L3 4932
156 5T6R 5 E 60S ribosomal protein L3 4932
157 5T5H 29 f Ribosomal protein L13 5693
158 5T2A 30 d uL3 5661
159 5T2C 4 E 60S ribosomal protein L3 9606
160 5LKS 5 LB 60S ribosomal protein L3 9606
161 5JUO 7 G uL3 (yeast L3) 4932
162 5JUP 7 G uL3 (yeast L3) 4932
163 5JUS 7 G uL3 (yeast L3) 4932
164 5JUT 7 G uL3 (yeast L3) 4932
165 5JUU 7 G uL3 (yeast L3) 4932
166 5JCS 3 B 60S ribosomal protein L3 4932
167 5IT7 5 BB 60S ribosomal protein L3 28985
168 3JCT 2 B 60S ribosomal protein L3 4932
169 3JCS 10 B ribosomal protein L3 5661
170 5GAK 17 F 60S ribosomal protein L3 4932
171 5FL8 2 B 60S ribosomal protein L3 4932
172 5APN 5 B 60S ribosomal protein L3 4932
173 5APO 5 B 60S ribosomal protein L3 4932
174 3JBN 70 AE 60S ribosomal protein uL3 5833
175 3JBO 70 AE 60S ribosomal protein uL3 5833
176 3JBP 70 AE 60S ribosomal protein uL3 5833
177 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
178 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
179 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
180 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
181 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
182 3JAG 2 B uL3 9986
183 3JAH 2 B uL3 9986
184 3JAI 2 B uL3 9986
185 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
186 5AJ0 4 AB 60S ribosomal protein L3 9606
187 3J92 2 B uL3 9986
188 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
189 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
190 4V3P 80 LC Ribosomal protein L3 4565
191 3J7O 5 B Ribosomal protein uL3 9823
192 3J7P 5 B Ribosomal protein uL3 9823
193 3J7Q 5 B Ribosomal protein uL3 9823
194 3J7R 5 B Ribosomal protein uL3 9823
195 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
196 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
197 3J79 5 E 60S ribosomal protein uL3 5833
198 3J77 3 L3 60S ribosomal protein L3 4932
199 3J78 3 L3 60S ribosomal protein L3 4932
200 3J6X 6 L3 60S ribosomal protein L3 4932
201 3J6Y 6 L3 60S ribosomal protein L3 4932
202 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
203 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
204 4V7F 6 C 60S ribosomal protein L3 4932
205 4V7E 71 CB 60S ribosomal protein L3 4565
206 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
207 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
208 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
209 4V6W 63 CB 60S ribosomal protein L3 7227
210 4V6X 63 CB 60S ribosomal protein L3 9606
211 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
212 4V6U 33 BC 50S ribosomal protein L3P 2261
213 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
214 4ADX 12 B RPL3 145262
215 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
216 4V7H 27 BC 60S ribosomal protein L3 5541
217 4V5Z 54 Bb 60S Ribosomal protein L3 9612
218 4V4B 22 BC 60S ribosomal protein L3 4932
219 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
220 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274