Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 888
95 % 35 68 708 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 739
70 % 35 68 792
50 % 35 181 204
40 % 43 547 20
30 % 43 547 36
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 62115
95 % 1 1 43347
90 % 1 1 41164
70 % 35 68 784
50 % 35 177 212
40 % 35 177 231
30 % 35 177 240
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 453
95 % 35 74 628 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 657
70 % 35 74 700
50 % 35 74 753
40 % 35 74 790
30 % 42 527 39
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 451
95 % 35 74 626 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 655
70 % 35 74 697
50 % 35 76 728
40 % 35 76 763
30 % 35 79 723
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 521
95 % 35 68 710 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 742
70 % 35 68 795
50 % 35 70 804
40 % 35 70 843
30 % 35 70 826
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2329
95 % 35 68 707 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 738
70 % 35 68 791
50 % 35 68 835
40 % 35 72 816
30 % 35 72 802
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 522
95 % 35 68 712 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 744
70 % 35 68 797
50 % 35 70 806
40 % 35 70 844
30 % 35 71 813
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 533
95 % 35 68 705 Flexibility: No
Max RMSD: 5.1, Avg RMSD: 0.4
PDBFlex
90 % 35 68 736
70 % 35 68 788
50 % 35 68 832
40 % 35 68 867
30 % 35 180 233
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 458
95 % 35 74 632 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 661
70 % 35 74 706
50 % 35 76 733
40 % 35 78 744
30 % 42 429 61
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 457
95 % 35 74 631 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 660
70 % 35 74 704
50 % 35 184 202
40 % 35 185 220
30 % 35 185 229
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 491
95 % 33 70 681 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 708
70 % 33 70 760
50 % 33 70 807
40 % 33 70 845
30 % 33 70 828
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 459
95 % 35 74 633 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 662
70 % 35 74 707
50 % 35 74 758
40 % 42 390 53
30 % 42 416 67
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 518
95 % 35 68 706 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 737
70 % 35 68 789
50 % 35 68 833
40 % 35 70 842
30 % 35 71 811
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 524
95 % 35 68 714 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 746
70 % 35 68 799
50 % 35 68 840
40 % 35 68 871
30 % 35 68 854
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 65612
95 % 3 5 14763 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 14490
70 % 3 5 13607
50 % 3 5 12082
40 % 3 5 10954
30 % 3 5 9511
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 72136
95 % 1 1 50035
90 % 1 1 47466
70 % 3 21 3017
50 % 7 30 2014
40 % 7 135 293
30 % 26 158 266
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 525
95 % 35 68 715 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 747
70 % 35 68 800
50 % 35 69 820
40 % 35 69 855
30 % 35 69 841
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 73593
95 % 35 68 716 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 748
70 % 35 68 801
50 % 35 178 207
40 % 35 178 228
30 % 35 178 237
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 523
95 % 35 68 713 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.4
PDBFlex
90 % 35 68 745
70 % 35 68 798
50 % 35 68 839
40 % 35 68 870
30 % 35 174 245
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 517
95 % 35 68 704 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 734
70 % 35 68 786
50 % 35 68 831
40 % 35 179 225
30 % 43 538 38
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2311
95 % 35 68 702 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 732
70 % 35 68 783
50 % 35 176 211
40 % 35 178 226
30 % 35 178 235
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 55065
95 % 35 74 618 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 649
70 % 35 74 692
50 % 35 74 745
40 % 35 185 218
30 % 35 185 227
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10436
95 % 35 74 621 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 652
70 % 35 74 694
50 % 35 74 747
40 % 35 76 759
30 % 36 78 739
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 452
95 % 35 74 627 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 656
70 % 35 74 698
50 % 35 74 751
40 % 36 185 219
30 % 36 185 228
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2341
95 % 3 21 2988 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 741
70 % 35 68 794
50 % 50 105 363
40 % 57 126 285
30 % 57 128 288
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 64454
95 % 1 1 44655
90 % 1 7 10530
70 % 3 27 2249
50 % 35 74 752
40 % 35 79 729
30 % 35 79 726
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 455
95 % 35 74 629
90 % 35 74 658
70 % 35 74 702
50 % 35 74 757
40 % 36 77 753
30 % 36 78 744

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 4U53 40 L3, l3 60S ribosomal protein L3 4932
79 1Q86 5 D 50S ribosomal protein L3P 2238
80 4U50 40 L3, l3 60S ribosomal protein L3 4932
81 5LYB 40 L3, l3 60S ribosomal protein L3 4932
82 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
83 3G4S 3 B 50S ribosomal protein L3P 2238
84 3CCJ 2 B 50S ribosomal protein L3P 2238
85 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
86 4U56 40 L3, l3 60S ribosomal protein L3 4932
87 2QA4 4 B 50S ribosomal protein L3P 2238
88 5TGA 40 L3, l3 60S ribosomal protein L3 4932
89 5MEI 5 CE, k 60S ribosomal protein L3 4932
90 1Q7Y 5 D 50S ribosomal protein L3P 2238
91 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
92 4U4O 40 L3, l3 60S ribosomal protein L3 4932
93 5DGV 40 L3, l3 60S ribosomal protein L3 4932
94 5DGE 40 L3, l3 60S ribosomal protein L3 4932
95 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
96 5FCI 40 L3, l3 60S ribosomal protein L3 4932
97 5DC3 40 L3, l3 60S ribosomal protein L3 4932
98 5DGF 40 L3, l3 60S ribosomal protein L3 4932
99 5TGM 40 L3, l3 60S ribosomal protein L3 4932
100 4V7R 34 BC, DC 60S ribosomal protein L3 4932
101 4V4P 5 AE 50S ribosomal protein L3 274
102 4V4R 29 BE 50S ribosomal protein L3 274
103 4V4S 29 BE 50S ribosomal protein L3 274
104 4V4T 28 BE 50S ribosomal protein L3 274
105 6AZ3 2 B ribosomal protein uL3 5661
106 5XY3 5 B Uncharacterized protein 5722
107 5XXB 5 B Ribosomal protein uL3 5811
108 5UMD 5 E 60S ribosomal protein L3 5833
109 5MC6 67 BA 60S ribosomal protein L3 4932
110 5H4P 5 B 60S ribosomal protein L3 4932
111 5M1J 42 B5 60S ribosomal protein L3 4932
112 5LZS 2 B Uncharacterized protein 9986
113 5LZT 2 B uL3 9986
114 5LZU 2 B uL3 9986
115 5LZV 2 B uL3 9986
116 5LZW 2 B uL3 9986
117 5LZX 2 B Ul3 9986
118 5LZY 2 B uL3 9986
119 5LZZ 2 B uL3 9986
120 5T62 6 E 60S ribosomal protein L3 4932
121 5T6R 5 E 60S ribosomal protein L3 4932
122 5T5H 29 f Ribosomal protein L13 5693
123 5T2A 30 d uL3 5661
124 5T2C 4 E 60S ribosomal protein L3 9606
125 5LKS 5 LB 60S ribosomal protein L3 9606
126 5JUO 7 G uL3 (yeast L3) 4932
127 5JUP 7 G uL3 (yeast L3) 4932
128 5JUS 7 G uL3 (yeast L3) 4932
129 5JUT 7 G uL3 (yeast L3) 4932
130 5JUU 7 G uL3 (yeast L3) 4932
131 5JCS 3 B 60S ribosomal protein L3 4932
132 5IT7 5 BB 60S ribosomal protein L3 28985
133 3JCT 2 B 60S ribosomal protein L3 4932
134 3JCS 10 B ribosomal protein L3 5661
135 5GAK 17 F 60S ribosomal protein L3 4932
136 5FL8 2 B 60S ribosomal protein L3 4932
137 5APN 5 B 60S ribosomal protein L3 4932
138 5APO 5 B 60S ribosomal protein L3 4932
139 3JBN 70 AE 60S ribosomal protein uL3 5833
140 3JBO 70 AE 60S ribosomal protein uL3 5833
141 3JBP 70 AE 60S ribosomal protein uL3 5833
142 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
143 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
144 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
145 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
146 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
147 3JAG 2 B uL3 9986
148 3JAH 2 B uL3 9986
149 3JAI 2 B uL3 9986
150 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
151 5AJ0 4 AB 60S ribosomal protein L3 9606
152 3J92 2 B uL3 9986
153 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
154 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
155 4V3P 80 LC Ribosomal protein L3 4565
156 3J7O 5 B Ribosomal protein uL3 9823
157 3J7P 5 B Ribosomal protein uL3 9823
158 3J7Q 5 B Ribosomal protein uL3 9823
159 3J7R 5 B Ribosomal protein uL3 9823
160 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
161 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
162 3J79 5 E 60S ribosomal protein uL3 5833
163 3J77 3 L3 60S ribosomal protein L3 4932
164 3J78 3 L3 60S ribosomal protein L3 4932
165 3J6X 6 L3 60S ribosomal protein L3 4932
166 3J6Y 6 L3 60S ribosomal protein L3 4932
167 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
168 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
169 4V7F 6 C 60S ribosomal protein L3 4932
170 4V7E 71 CB 60S ribosomal protein L3 4565
171 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
172 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
173 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
174 4V6W 63 CB 60S ribosomal protein L3 7227
175 4V6X 63 CB 60S ribosomal protein L3 9606
176 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
177 4V6U 33 BC 50S ribosomal protein L3P 2261
178 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
179 4ADX 12 B RPL3 145262
180 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
181 4V7H 27 BC 60S ribosomal protein L3 5541
182 4V5Z 54 Bb 60S Ribosomal protein L3 9612
183 4V4B 22 BC 60S ribosomal protein L3 4932
184 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
185 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274