Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 869
95 % 35 68 701 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 731
70 % 35 68 784
50 % 35 180 201
40 % 43 543 20
30 % 43 543 33
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 61399
95 % 1 1 42847
90 % 1 1 40717
70 % 35 68 776
50 % 35 176 205
40 % 35 176 230
30 % 35 176 242
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 447
95 % 35 74 621 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 650
70 % 35 74 693
50 % 35 74 744
40 % 35 74 780
30 % 42 523 37
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 445
95 % 35 74 619 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.5
PDBFlex
90 % 35 74 648
70 % 35 74 690
50 % 35 76 719
40 % 35 76 755
30 % 35 79 719
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 516
95 % 35 68 703 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 734
70 % 35 68 787
50 % 35 70 797
40 % 35 70 833
30 % 35 70 820
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2279
95 % 35 68 700 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 730
70 % 35 68 783
50 % 35 68 829
40 % 35 72 808
30 % 35 72 799
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 517
95 % 35 68 705 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 736
70 % 35 68 789
50 % 35 70 798
40 % 35 70 834
30 % 35 71 809
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 526
95 % 35 68 698 Flexibility: No
Max RMSD: 0.3, Avg RMSD: 0.2
PDBFlex
90 % 35 68 728
70 % 35 68 780
50 % 35 68 826
40 % 35 68 861
30 % 35 179 233
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 452
95 % 35 74 625 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 654
70 % 35 74 700
50 % 35 76 724
40 % 35 78 736
30 % 42 426 59
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 451
95 % 35 74 624 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 653
70 % 35 74 698
50 % 35 183 199
40 % 35 184 218
30 % 35 184 228
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 485
95 % 33 70 674 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 700
70 % 33 70 753
50 % 33 70 799
40 % 33 70 835
30 % 33 70 822
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 453
95 % 35 74 626 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 655
70 % 35 74 701
50 % 35 74 749
40 % 42 387 52
30 % 42 413 64
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 513
95 % 35 68 699 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 729
70 % 35 68 781
50 % 35 68 827
40 % 35 70 831
30 % 35 71 807
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 519
95 % 35 68 707 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 738
70 % 35 68 791
50 % 35 68 834
40 % 35 68 865
30 % 35 68 849
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 64866
95 % 3 5 14601 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.6
PDBFlex
90 % 3 5 14329
70 % 3 5 13461
50 % 3 5 11956
40 % 3 5 10846
30 % 3 5 9412
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 71346
95 % 1 1 49513
90 % 1 1 47002
70 % 3 21 2978
50 % 7 30 1986
40 % 7 134 287
30 % 26 157 264
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 520
95 % 35 68 708 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 739
70 % 35 68 792
50 % 35 69 813
40 % 35 69 847
30 % 35 69 837
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 72797
95 % 35 68 709 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 35 68 740
70 % 35 68 793
50 % 35 177 203
40 % 35 177 226
30 % 35 177 237
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 518
95 % 35 68 706 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.4
PDBFlex
90 % 35 68 737
70 % 35 68 790
50 % 35 68 833
40 % 35 68 864
30 % 35 173 245
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 512
95 % 35 68 697 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 726
70 % 35 68 778
50 % 35 68 825
40 % 35 178 222
30 % 43 534 36
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2262
95 % 35 68 695 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 724
70 % 35 68 775
50 % 35 175 204
40 % 35 177 225
30 % 35 177 236
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 54443
95 % 35 74 611 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.3
PDBFlex
90 % 35 74 642
70 % 35 74 686
50 % 35 74 737
40 % 35 184 216
30 % 35 184 226
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10302
95 % 35 74 615 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 646
70 % 35 74 688
50 % 35 74 739
40 % 35 76 753
30 % 36 78 729
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 446
95 % 35 74 620 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 649
70 % 35 74 691
50 % 35 74 742
40 % 36 184 217
30 % 36 184 227
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2291
95 % 3 21 2944 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 733
70 % 35 68 786
50 % 50 105 350
40 % 57 126 282
30 % 57 128 284
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 63722
95 % 1 1 44150
90 % 1 7 10419
70 % 3 27 2219
50 % 35 74 743
40 % 35 79 724
30 % 35 79 721
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 449
95 % 35 74 622 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 651
70 % 35 74 696
50 % 35 74 748
40 % 36 77 747
30 % 36 78 733

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 4U53 40 L3, l3 60S ribosomal protein L3 4932
79 1Q86 5 D 50S ribosomal protein L3P 2238
80 4U50 40 L3, l3 60S ribosomal protein L3 4932
81 5LYB 40 L3, l3 60S ribosomal protein L3 4932
82 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
83 3G4S 3 B 50S ribosomal protein L3P 2238
84 3CCJ 2 B 50S ribosomal protein L3P 2238
85 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
86 4U56 40 L3, l3 60S ribosomal protein L3 4932
87 2QA4 4 B 50S ribosomal protein L3P 2238
88 5TGA 40 L3, l3 60S ribosomal protein L3 4932
89 5MEI 5 CE, k 60S ribosomal protein L3 4932
90 1Q7Y 5 D 50S ribosomal protein L3P 2238
91 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
92 4U4O 40 L3, l3 60S ribosomal protein L3 4932
93 5DGV 40 L3, l3 60S ribosomal protein L3 4932
94 5DGE 40 L3, l3 60S ribosomal protein L3 4932
95 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
96 5FCI 40 L3, l3 60S ribosomal protein L3 4932
97 5DC3 40 L3, l3 60S ribosomal protein L3 4932
98 5DGF 40 L3, l3 60S ribosomal protein L3 4932
99 5TGM 40 L3, l3 60S ribosomal protein L3 4932
100 4V7R 34 BC, DC 60S ribosomal protein L3 4932
101 4V4P 5 AE 50S ribosomal protein L3 274
102 4V4R 29 BE 50S ribosomal protein L3 274
103 4V4S 29 BE 50S ribosomal protein L3 274
104 4V4T 28 BE 50S ribosomal protein L3 274
105 5XY3 5 B Uncharacterized protein 5722
106 5XXB 5 B Ribosomal protein uL3 5811
107 5UMD 5 E 60S ribosomal protein L3 5833
108 5MC6 67 BA 60S ribosomal protein L3 4932
109 5H4P 5 B 60S ribosomal protein L3 4932
110 5M1J 42 B5 60S ribosomal protein L3 4932
111 5LZS 2 B Uncharacterized protein 9986
112 5LZT 2 B uL3 9986
113 5LZU 2 B uL3 9986
114 5LZV 2 B uL3 9986
115 5LZW 2 B uL3 9986
116 5LZX 2 B Ul3 9986
117 5LZY 2 B uL3 9986
118 5LZZ 2 B uL3 9986
119 5T62 6 E 60S ribosomal protein L3 4932
120 5T6R 5 E 60S ribosomal protein L3 4932
121 5T5H 29 f Ribosomal protein L13 5693
122 5T2A 30 d uL3 5661
123 5T2C 4 E 60S ribosomal protein L3 9606
124 5LKS 5 LB 60S ribosomal protein L3 9606
125 5JUO 7 G uL3 (yeast L3) 4932
126 5JUP 7 G uL3 (yeast L3) 4932
127 5JUS 7 G uL3 (yeast L3) 4932
128 5JUT 7 G uL3 (yeast L3) 4932
129 5JUU 7 G uL3 (yeast L3) 4932
130 5JCS 3 B 60S ribosomal protein L3 4932
131 5IT7 5 BB 60S ribosomal protein L3 28985
132 3JCT 2 B 60S ribosomal protein L3 4932
133 3JCS 10 B ribosomal protein L3 5661
134 5GAK 17 F 60S ribosomal protein L3 4932
135 5FL8 2 B 60S ribosomal protein L3 4932
136 5APN 5 B 60S ribosomal protein L3 4932
137 5APO 5 B 60S ribosomal protein L3 4932
138 3JBN 70 AE 60S ribosomal protein uL3 5833
139 3JBO 70 AE 60S ribosomal protein uL3 5833
140 3JBP 70 AE 60S ribosomal protein uL3 5833
141 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
142 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
143 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
144 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
145 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
146 3JAG 2 B uL3 9986
147 3JAH 2 B uL3 9986
148 3JAI 2 B uL3 9986
149 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
150 5AJ0 4 AB 60S ribosomal protein L3 9606
151 3J92 2 B uL3 9986
152 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
153 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
154 4V3P 80 LC Ribosomal protein L3 4565
155 3J7O 5 B Ribosomal protein uL3 9823
156 3J7P 5 B Ribosomal protein uL3 9823
157 3J7Q 5 B Ribosomal protein uL3 9823
158 3J7R 5 B Ribosomal protein uL3 9823
159 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
160 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
161 3J79 5 E 60S ribosomal protein uL3 5833
162 3J77 3 L3 60S ribosomal protein L3 4932
163 3J78 3 L3 60S ribosomal protein L3 4932
164 3J6X 6 L3 60S ribosomal protein L3 4932
165 3J6Y 6 L3 60S ribosomal protein L3 4932
166 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
167 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
168 4V7F 6 C 60S ribosomal protein L3 4932
169 4V7E 71 CB 60S ribosomal protein L3 4565
170 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
171 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
172 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
173 4V6W 63 CB 60S ribosomal protein L3 7227
174 4V6X 63 CB 60S ribosomal protein L3 9606
175 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
176 4V6U 33 BC 50S ribosomal protein L3P 2261
177 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
178 4ADX 12 B RPL3 145262
179 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
180 4V7H 27 BC 60S ribosomal protein L3 5541
181 4V5Z 54 Bb 60S Ribosomal protein L3 9612
182 4V4B 22 BC 60S ribosomal protein L3 4932
183 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
184 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274