Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 16 44 856
95 % 35 68 690 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 68 719
70 % 35 68 772
50 % 35 178 202
40 % 43 534 20
30 % 43 534 33
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 60591
95 % 1 1 42268
90 % 1 1 40182
70 % 35 68 763
50 % 35 174 207
40 % 35 174 230
30 % 35 174 240
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 446
95 % 35 74 618 Flexibility: No
Max RMSD: 1.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 646
70 % 35 74 685
50 % 35 74 736
40 % 35 74 768
30 % 42 514 37
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 74 444
95 % 35 74 616
90 % 35 74 644
70 % 35 74 682
50 % 35 76 706
40 % 35 76 741
30 % 35 79 697
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 504
95 % 35 68 691 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 721
70 % 35 68 774
50 % 35 70 791
40 % 35 70 826
30 % 35 70 815
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2248
95 % 35 68 689 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.2
PDBFlex
90 % 35 68 717
70 % 35 68 770
50 % 35 68 819
40 % 35 72 798
30 % 35 72 790
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 505
95 % 35 68 693 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 723
70 % 35 68 776
50 % 35 70 792
40 % 35 70 827
30 % 35 71 801
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 34 67 515
95 % 35 68 687 Flexibility: No
Max RMSD: 5.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 715
70 % 35 68 767
50 % 35 68 816
40 % 35 68 852
30 % 35 177 233
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 450
95 % 35 74 622 Flexibility: No
Max RMSD: 1.3, Avg RMSD: 0.3
PDBFlex
90 % 35 74 650
70 % 35 74 693
50 % 35 76 711
40 % 35 78 717
30 % 42 419 58
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 449
95 % 35 74 621 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 649
70 % 35 74 690
50 % 35 182 198
40 % 35 182 217
30 % 35 182 226
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 33 70 478
95 % 33 70 666 Flexibility: No
Max RMSD: 0.8, Avg RMSD: 0.2
PDBFlex
90 % 33 70 690
70 % 33 70 743
50 % 33 70 793
40 % 33 70 828
30 % 33 70 817
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 451
95 % 35 74 623 Flexibility: No
Max RMSD: 0.9, Avg RMSD: 0.3
PDBFlex
90 % 35 74 651
70 % 35 74 694
50 % 35 74 743
40 % 42 383 58
30 % 42 409 65
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 501
95 % 35 68 688 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 716
70 % 35 68 768
50 % 35 68 817
40 % 35 70 823
30 % 35 71 800
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 507
95 % 35 68 695 Flexibility: No
Max RMSD: 2.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 725
70 % 35 68 778
50 % 35 68 823
40 % 35 68 856
30 % 35 68 842
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 63972
95 % 3 5 14391 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 0.7
PDBFlex
90 % 3 5 14115
70 % 3 5 13242
50 % 3 5 11773
40 % 3 5 10679
30 % 3 5 9262
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 70314
95 % 1 1 48740
90 % 1 1 46284
70 % 3 21 2938
50 % 7 30 1965
40 % 7 131 300
30 % 26 154 266
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 508
95 % 35 68 696 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 726
70 % 35 68 779
50 % 35 69 804
40 % 35 69 840
30 % 35 69 831
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 71735
95 % 35 68 697 Flexibility: No
Max RMSD: 0.5, Avg RMSD: 0.3
PDBFlex
90 % 35 68 727
70 % 35 68 780
50 % 35 175 203
40 % 35 175 226
30 % 35 175 237
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 506
95 % 35 68 694 Flexibility: No
Max RMSD: 1.2, Avg RMSD: 0.3
PDBFlex
90 % 35 68 724
70 % 35 68 777
50 % 35 68 822
40 % 35 68 855
30 % 35 171 243
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 68 500
95 % 35 68 686 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 68 713
70 % 35 68 765
50 % 35 68 815
40 % 35 176 223
30 % 43 525 36
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2231
95 % 35 68 684 Flexibility: No
Max RMSD: 0.6, Avg RMSD: 0.3
PDBFlex
90 % 35 68 711
70 % 35 68 762
50 % 35 173 206
40 % 35 175 225
30 % 35 175 236
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 53734
95 % 35 74 608 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.2
PDBFlex
90 % 35 74 638
70 % 35 74 678
50 % 35 74 729
40 % 35 182 215
30 % 35 182 224
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 10176
95 % 35 74 612 Flexibility: No
Max RMSD: 0.7, Avg RMSD: 0.2
PDBFlex
90 % 35 74 642
70 % 35 74 680
50 % 35 74 731
40 % 35 76 739
30 % 36 78 706
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 445
95 % 35 74 617 Flexibility: No
Max RMSD: 1.1, Avg RMSD: 0.4
PDBFlex
90 % 35 74 645
70 % 35 74 683
50 % 35 74 734
40 % 36 182 216
30 % 36 182 225
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 3 21 2260
95 % 3 21 2902 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.1
PDBFlex
90 % 35 68 720
70 % 35 68 773
50 % 50 105 345
40 % 57 124 284
30 % 57 126 289
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 62869
95 % 1 1 43533
90 % 1 7 10271
70 % 3 27 2202
50 % 35 74 735
40 % 35 79 705
30 % 35 79 699
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 35 74 447
95 % 35 74 619 Flexibility: No
Max RMSD: 0.4, Avg RMSD: 0.2
PDBFlex
90 % 35 74 647
70 % 35 74 688
50 % 35 74 740
40 % 36 77 733
30 % 36 78 712

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CC7 2 B 50S ribosomal protein L3P 2238
20 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
21 3CCE 2 B 50S ribosomal protein L3P 2238
22 3G6E 3 B 50S ribosomal protein L3P 2238
23 3CPW 4 B 50S ribosomal protein L3P 2238
24 3CCU 2 B 50S ribosomal protein L3P 2238
25 1VQ6 6 B 50S ribosomal protein L3P 2238
26 1M90 5 D RIBOSOMAL PROTEIN L3 2238
27 3CCL 2 B 50S ribosomal protein L3P 2238
28 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
29 1YJ9 4 B 50S ribosomal protein L3P 2238
30 3CD6 2 B 50S ribosomal protein L3P 2238
31 3CCV 2 B 50S ribosomal protein L3P 2238
32 3CC4 2 B 50S ribosomal protein L3P 2238
33 2OTL 4 B 50S ribosomal protein L3P 2238
34 3G71 3 B 50S ribosomal protein L3P 2238
35 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
36 1VQ4 5 B 50S ribosomal protein L3P 2238
37 1YJN 4 B 50S ribosomal protein L3P 2238
38 3CMA 2 B 50S ribosomal protein L3P 2238
39 3CCS 2 B 50S ribosomal protein L3P 2238
40 3CCQ 2 B 50S ribosomal protein L3P 2238
41 3I56 2 B 50S ribosomal protein L3P 2238
42 3CCR 2 B 50S ribosomal protein L3P 2238
43 2OTJ 4 B 50S ribosomal protein L3P 2238
44 4V88 40 BB, DB 60S ribosomal protein L3 4932
45 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
46 3OW2 4 B 50S ribosomal protein L3P 2238
47 4U4R 40 L3, l3 60S ribosomal protein L3 4932
48 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
49 1QVG 5 B 50S ribosomal protein L3P 2238
50 3CME 2 B 50S ribosomal protein L3P 2238
51 2QEX 4 B 50S ribosomal protein L3P 2238
52 4U3U 40 L3, l3 60S ribosomal protein L3 4932
53 5TBW 5 CE, k 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 4U53 40 L3, l3 60S ribosomal protein L3 4932
79 1Q86 5 D 50S ribosomal protein L3P 2238
80 4U50 40 L3, l3 60S ribosomal protein L3 4932
81 5LYB 40 L3, l3 60S ribosomal protein L3 4932
82 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
83 3G4S 3 B 50S ribosomal protein L3P 2238
84 3CCJ 2 B 50S ribosomal protein L3P 2238
85 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
86 4U56 40 L3, l3 60S ribosomal protein L3 4932
87 2QA4 4 B 50S ribosomal protein L3P 2238
88 5TGA 40 L3, l3 60S ribosomal protein L3 4932
89 5MEI 5 CE, k 60S ribosomal protein L3 4932
90 1Q7Y 5 D 50S ribosomal protein L3P 2238
91 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
92 4U4O 40 L3, l3 60S ribosomal protein L3 4932
93 5DGV 40 L3, l3 60S ribosomal protein L3 4932
94 5DGE 40 L3, l3 60S ribosomal protein L3 4932
95 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
96 5FCI 40 L3, l3 60S ribosomal protein L3 4932
97 5DC3 40 L3, l3 60S ribosomal protein L3 4932
98 5DGF 40 L3, l3 60S ribosomal protein L3 4932
99 5TGM 40 L3, l3 60S ribosomal protein L3 4932
100 4V7R 34 BC, DC 60S ribosomal protein L3 4932
101 4V4P 5 AE 50S ribosomal protein L3 274
102 4V4R 29 BE 50S ribosomal protein L3 274
103 4V4S 29 BE 50S ribosomal protein L3 274
104 4V4T 28 BE 50S ribosomal protein L3 274
105 5UMD 5 E 60S ribosomal protein L3 5833
106 5MC6 67 BA 60S ribosomal protein L3 4932
107 5H4P 5 B 60S ribosomal protein L3 4932
108 5M1J 42 B5 60S ribosomal protein L3 4932
109 5LZS 2 B Uncharacterized protein 9986
110 5LZT 2 B uL3 9986
111 5LZU 2 B uL3 9986
112 5LZV 2 B uL3 9986
113 5LZW 2 B uL3 9986
114 5LZX 2 B Ul3 9986
115 5LZY 2 B uL3 9986
116 5LZZ 2 B uL3 9986
117 5T62 6 E 60S ribosomal protein L3 4932
118 5T6R 5 E 60S ribosomal protein L3 4932
119 5T5H 29 f Ribosomal protein L13 5693
120 5T2A 30 d uL3 5661
121 5T2C 4 E 60S ribosomal protein L3 9606
122 5LKS 5 LB 60S ribosomal protein L3 9606
123 5JUO 7 G uL3 (yeast L3) 4932
124 5JUP 7 G uL3 (yeast L3) 4932
125 5JUS 7 G uL3 (yeast L3) 4932
126 5JUT 7 G uL3 (yeast L3) 4932
127 5JUU 7 G uL3 (yeast L3) 4932
128 5JCS 3 B 60S ribosomal protein L3 4932
129 5IT7 5 BB 60S ribosomal protein L3 28985
130 3JCT 2 B 60S ribosomal protein L3 4932
131 3JCS 10 B ribosomal protein L3 5661
132 5GAK 17 F 60S ribosomal protein L3 4932
133 5FL8 2 B 60S ribosomal protein L3 4932
134 5APN 5 B 60S ribosomal protein L3 4932
135 5APO 5 B 60S ribosomal protein L3 4932
136 3JBN 70 AE 60S ribosomal protein uL3 5833
137 3JBO 70 AE 60S ribosomal protein uL3 5833
138 3JBP 70 AE 60S ribosomal protein uL3 5833
139 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
140 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
141 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
142 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
143 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
144 3JAG 2 B uL3 9986
145 3JAH 2 B uL3 9986
146 3JAI 2 B uL3 9986
147 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
148 5AJ0 4 AB 60S ribosomal protein L3 9606
149 3J92 2 B uL3 9986
150 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
151 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
152 4V3P 80 LC Ribosomal protein L3 4565
153 3J7O 5 B Ribosomal protein uL3 9823
154 3J7P 5 B Ribosomal protein uL3 9823
155 3J7Q 5 B Ribosomal protein uL3 9823
156 3J7R 5 B Ribosomal protein uL3 9823
157 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
158 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
159 3J79 5 E 60S ribosomal protein uL3 5833
160 3J77 3 L3 60S ribosomal protein L3 4932
161 3J78 3 L3 60S ribosomal protein L3 4932
162 3J6X 6 L3 60S ribosomal protein L3 4932
163 3J6Y 6 L3 60S ribosomal protein L3 4932
164 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
165 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
166 4V7F 6 C 60S ribosomal protein L3 4932
167 4V7E 71 CB 60S ribosomal protein L3 4565
168 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
169 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
170 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
171 4V6W 63 CB 60S ribosomal protein L3 7227
172 4V6X 63 CB 60S ribosomal protein L3 9606
173 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
174 4V6U 33 BC 50S ribosomal protein L3P 2261
175 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
176 4ADX 12 B RPL3 145262
177 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
178 4V7H 27 BC 60S ribosomal protein L3 5541
179 4V5Z 54 Bb 60S Ribosomal protein L3 9612
180 4V4B 22 BC 60S ribosomal protein L3 4932
181 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
182 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274