Sequence Similarity Clusters for the Entities in PDB 1FFK

Entity #1 | Chains: 0
23S RRNA rna, length: 2922 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: H
RIBOSOMAL PROTEIN L14 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 17 44 799
95 % 36 68 632
90 % 36 68 659
70 % 36 68 700
50 % 36 168 203
40 % 36 168 224
30 % 44 495 30
Entity #11 | Chains: I
RIBOSOMAL PROTEIN L15E protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 57535
95 % 1 1 40079
90 % 1 1 38166
70 % 36 68 691
50 % 36 164 212
40 % 36 164 234
30 % 36 164 239
Entity #12 | Chains: J
RIBOSOMAL PROTEIN L15 protein, length: 164 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 391
95 % 36 74 551
90 % 36 74 584
70 % 36 74 617
50 % 36 74 666
40 % 36 74 708
30 % 43 481 35
Entity #13 | Chains: K
RIBOSOMAL PROTEIN L18 protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 389
95 % 36 74 549
90 % 36 74 582
70 % 36 74 614
50 % 36 76 645
40 % 36 76 689
30 % 36 79 663
Entity #14 | Chains: L
RIBOSOMAL PROTEIN L18E protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 448
95 % 36 68 633
90 % 36 68 661
70 % 36 68 702
50 % 36 70 720
40 % 36 70 760
30 % 36 70 760
Entity #15 | Chains: M
RIBOSOMAL PROTEIN L19 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2115
95 % 36 68 631
90 % 36 68 657
70 % 36 68 698
50 % 36 68 750
40 % 36 72 729
30 % 36 72 727
Entity #16 | Chains: N
RIBOSOMAL PROTEIN L21E protein, length: 95 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 450
95 % 36 68 636
90 % 36 68 663
70 % 36 68 707
50 % 36 70 721
40 % 36 70 761
30 % 36 71 742
Entity #17 | Chains: O
RIBOSOMAL PROTEIN L22 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 67 458
95 % 36 68 628
90 % 36 68 654
70 % 36 68 694
50 % 36 68 747
40 % 36 68 780
30 % 36 167 234
Entity #18 | Chains: P
RIBOSOMAL PROTEIN L23 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 398
95 % 36 74 558
90 % 36 74 589
70 % 36 74 623
50 % 36 76 647
40 % 36 78 666
30 % 43 396 56
Entity #19 | Chains: Q
RIBOSOMAL PROTEIN L24 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 397
95 % 36 74 557
90 % 36 74 588
70 % 36 74 622
50 % 36 172 198
40 % 36 172 219
30 % 36 172 227
Entity #2 | Chains: 9
5S RRNA rna, length: 122 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
RIBOSOMAL PROTEIN L24E protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 34 70 430
95 % 34 70 609
90 % 34 70 636
70 % 34 70 670
50 % 34 70 722
40 % 34 70 763
30 % 34 70 762
Entity #21 | Chains: S
RIBOSOMAL PROTEIN L29 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 399
95 % 36 74 559
90 % 36 74 590
70 % 36 74 624
50 % 36 74 671
40 % 36 74 712
30 % 36 74 711
Entity #22 | Chains: T
RIBOSOMAL PROTEIN L30 protein, length: 154 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 446
95 % 36 68 630
90 % 36 68 656
70 % 36 68 696
50 % 36 68 748
40 % 36 70 757
30 % 36 71 740
Entity #23 | Chains: U
RIBOSOMAL PROTEIN L31E protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 452
95 % 36 68 638
90 % 36 68 665
70 % 36 68 709
50 % 36 68 754
40 % 36 68 784
30 % 36 68 785
Entity #24 | Chains: V
RIBOSOMAL PROTEIN L32E protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 60821
95 % 3 5 13606
90 % 3 5 13361
70 % 3 5 12538
50 % 3 5 11209
40 % 3 5 10174
30 % 3 5 8829
Entity #25 | Chains: W
RIBOSOMAL PROTEIN L37AE protein, length: 73 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 67053
95 % 1 1 46457
90 % 1 1 44199
70 % 3 21 2783
50 % 7 30 1856
40 % 7 121 306
30 % 26 144 268
Entity #26 | Chains: X
RIBOSOMAL PROTEIN L37E protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 453
95 % 36 68 639
90 % 36 68 666
70 % 36 68 711
50 % 36 69 733
40 % 36 69 774
30 % 36 69 776
Entity #27 | Chains: Y
RIBOSOMAL PROTEIN L39E protein, length: 49 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 68440
95 % 36 68 640
90 % 36 68 667
70 % 36 68 712
50 % 36 165 205
40 % 36 165 229
30 % 36 165 236
Entity #28 | Chains: Z
RIBOSOMAL PROTEIN L44E protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 451
95 % 36 68 637
90 % 36 68 664
70 % 36 68 708
50 % 36 68 753
40 % 36 68 783
30 % 36 161 243
Entity #29 | Chains: 1
RIBOSOMAL PROTEIN L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 68 444
95 % 36 68 627
90 % 36 68 653
70 % 36 68 693
50 % 36 68 746
40 % 36 166 227
30 % 44 486 34
Entity #3 | Chains: A
RIBOSOMAL PROTEIN L2 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2095
95 % 36 68 624
90 % 36 68 651
70 % 36 68 690
50 % 36 163 211
40 % 36 165 228
30 % 36 165 235
Entity #4 | Chains: B
RIBOSOMAL PROTEIN L3 protein, length: 337 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 50907
95 % 36 74 543
90 % 36 74 578
70 % 36 74 609
50 % 36 74 659
40 % 36 172 217
30 % 36 172 225
Entity #5 | Chains: C
RIBOSOMAL PROTEIN L4 protein, length: 246 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 7 9604
95 % 36 74 545
90 % 36 74 580
70 % 36 74 613
50 % 36 74 662
40 % 36 76 687
30 % 36 77 681
Entity #6 | Chains: D
RIBOSOMAL PROTEIN L5 protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 390
95 % 36 74 550
90 % 36 74 583
70 % 36 74 615
50 % 36 74 664
40 % 37 172 218
30 % 37 172 226
Entity #7 | Chains: E
RIBOSOMAL PROTEIN L7AE protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 21 2125
95 % 3 21 2752
90 % 36 68 660
70 % 36 68 701
50 % 51 105 307
40 % 58 120 278
30 % 58 122 277
Entity #8 | Chains: F
RIBOSOMAL PROTEIN L10E protein, length: 157 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 59753
95 % 1 1 41317
90 % 1 7 9702
70 % 3 27 2056
50 % 36 74 665
40 % 36 79 654
30 % 36 79 666
Entity #9 | Chains: G
RIBOSOMAL PROTEIN L13 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 36 74 392
95 % 36 74 552
90 % 36 74 585
70 % 36 74 620
50 % 36 74 669
40 % 37 77 679
30 % 37 78 673

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V9F 4 B 50S ribosomal protein L3P 2238
2 1VQO 5 B 50S ribosomal protein L3P 2238
3 1VQ8 5 B 50S ribosomal protein L3P 2238
4 1S72 4 B 50S ribosomal protein L3P 2238
5 1JJ2 4 B RIBOSOMAL PROTEIN L3 2238
6 1YHQ 4 B 50S ribosomal protein L3P 2238
7 1VQP 5 B 50S ribosomal protein L3P 2238
8 1VQM 5 B 50S ribosomal protein L3P 2238
9 3CC2 2 B 50S ribosomal protein L3P 2238
10 1VQL 5 B 50S ribosomal protein L3P 2238
11 1VQK 5 B 50S ribosomal protein L3P 2238
12 1VQN 6 B 50S ribosomal protein L3P 2238
13 1YIJ 4 B 50S ribosomal protein L3P 2238
14 1YI2 4 B 50S ribosomal protein L3P 2238
15 1VQ9 5 B 50S ribosomal protein L3P 2238
16 1VQ7 5 B 50S ribosomal protein L3P 2238
17 3CCM 2 B 50S ribosomal protein L3P 2238
18 1VQ5 5 B 50S ribosomal protein L3P 2238
19 3CCJ 2 B 50S ribosomal protein L3P 2238
20 3CC7 2 B 50S ribosomal protein L3P 2238
21 1YIT 8 B 50S RIBOSOMAL PROTEIN L3P 2238
22 3CCE 2 B 50S ribosomal protein L3P 2238
23 3G6E 3 B 50S ribosomal protein L3P 2238
24 3CPW 4 B 50S ribosomal protein L3P 2238
25 3CCU 2 B 50S ribosomal protein L3P 2238
26 1VQ6 6 B 50S ribosomal protein L3P 2238
27 1M90 5 D RIBOSOMAL PROTEIN L3 2238
28 3CCL 2 B 50S ribosomal protein L3P 2238
29 1YJW 8 B 50S RIBOSOMAL PROTEIN L3P 2238
30 1YJ9 4 B 50S ribosomal protein L3P 2238
31 3CD6 2 B 50S ribosomal protein L3P 2238
32 3CCV 2 B 50S ribosomal protein L3P 2238
33 3CC4 2 B 50S ribosomal protein L3P 2238
34 2OTL 4 B 50S ribosomal protein L3P 2238
35 3G71 3 B 50S ribosomal protein L3P 2238
36 1FFK 4 B RIBOSOMAL PROTEIN L3 2238
37 1VQ4 5 B 50S ribosomal protein L3P 2238
38 1YJN 4 B 50S ribosomal protein L3P 2238
39 3CMA 2 B 50S ribosomal protein L3P 2238
40 3CCS 2 B 50S ribosomal protein L3P 2238
41 3CCQ 2 B 50S ribosomal protein L3P 2238
42 3I56 2 B 50S ribosomal protein L3P 2238
43 3CCR 2 B 50S ribosomal protein L3P 2238
44 2OTJ 4 B 50S ribosomal protein L3P 2238
45 4V88 40 BB, DB 60S ribosomal protein L3 4932
46 1KQS 6 B RIBOSOMAL PROTEIN L3 2238
47 3OW2 4 B 50S ribosomal protein L3P 2238
48 4U4R 40 L3, l3 60S ribosomal protein L3 4932
49 3CXC 5 B RIBOSOMAL PROTEIN L3 2238
50 1QVG 5 B 50S ribosomal protein L3P 2238
51 3CME 2 B 50S ribosomal protein L3P 2238
52 2QEX 4 B 50S ribosomal protein L3P 2238
53 4U3U 40 L3, l3 60S ribosomal protein L3 4932
54 1KC8 4 D RIBOSOMAL PROTEIN L3 2238
55 4U3M 40 L3, l3 60S ribosomal protein L3 4932
56 1N8R 4 D 50S ribosomal protein L3P 2238
57 4U3N 40 L3, l3 60S ribosomal protein L3 4932
58 1Q81 5 D 50S ribosomal protein L3P 2238
59 1Q82 5 D 50S ribosomal protein L3P 2238
60 1QVF 5 B 50S ribosomal protein L3P 2238
61 4U52 40 L3, l3 60S ribosomal protein L3 4932
62 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
63 1NJI 4 D 50S ribosomal protein L3P 2238
64 4U6F 40 L3, l3 60S ribosomal protein L3 4932
65 4U4U 40 L3, l3 60S ribosomal protein L3 4932
66 1K73 4 D RIBOSOMAL PROTEIN L3 2238
67 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
68 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
69 4U4N 40 L3, l3 60S ribosomal protein L3 4932
70 4U55 40 L3, l3 60S ribosomal protein L3 4932
71 1K9M 4 D RIBOSOMAL PROTEIN L3 2238
72 1KD1 4 D RIBOSOMAL PROTEIN L3 2238
73 5DAT 40 L3, l3 60S ribosomal protein L3 4932
74 3I55 3 B 50S ribosomal protein L3P 2238
75 5I4L 40 L3, l3 60S ribosomal protein L3 4932
76 4U51 40 L3, l3 60S ribosomal protein L3 4932
77 1K8A 4 D RIBOSOMAL PROTEIN L3 2238
78 4U53 40 L3, l3 60S ribosomal protein L3 4932
79 1Q86 5 D 50S ribosomal protein L3P 2238
80 4U50 40 L3, l3 60S ribosomal protein L3 4932
81 5LYB 40 L3, l3 60S ribosomal protein L3 4932
82 1M1K 4 D RIBOSOMAL PROTEIN L3 2238
83 3G4S 3 B 50S ribosomal protein L3P 2238
84 1W2B 7 B 50S RIBOSOMAL PROTEIN L3P 2238
85 4U56 40 L3, l3 60S ribosomal protein L3 4932
86 2QA4 4 B 50S ribosomal protein L3P 2238
87 5TGA 40 L3, l3 60S ribosomal protein L3 4932
88 1Q7Y 5 D 50S ribosomal protein L3P 2238
89 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
90 4U4O 40 L3, l3 60S ribosomal protein L3 4932
91 5DGV 40 L3, l3 60S ribosomal protein L3 4932
92 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
93 5FCI 40 L3, l3 60S ribosomal protein L3 4932
94 5DC3 40 L3, l3 60S ribosomal protein L3 4932
95 5DGF 40 L3, l3 60S ribosomal protein L3 4932
96 5TGM 40 L3, l3 60S ribosomal protein L3 4932
97 4V7R 34 BC, DC 60S ribosomal protein L3 4932
98 4V4P 5 AE 50S ribosomal protein L3 274
99 4V4R 29 BE 50S ribosomal protein L3 274
100 4V4S 29 BE 50S ribosomal protein L3 274
101 4V4T 28 BE 50S ribosomal protein L3 274
102 5MC6 67 BA 60S ribosomal protein L3 4932
103 5M1J 42 B5 60S ribosomal protein L3 4932
104 5LZS 2 B Uncharacterized protein 9986
105 5LZT 2 B uL3 9986
106 5LZU 2 B uL3 9986
107 5LZV 2 B uL3 9986
108 5LZW 2 B uL3 9986
109 5LZX 2 B Ul3 9986
110 5LZY 2 B uL3 9986
111 5LZZ 2 B uL3 9986
112 5T5H 29 f Ribosomal protein L13 5693
113 5JUO 7 G uL3 (yeast L3) 4932
114 5JUP 7 G uL3 (yeast L3) 4932
115 5JUS 7 G uL3 (yeast L3) 4932
116 5JUT 7 G uL3 (yeast L3) 4932
117 5JUU 7 G uL3 (yeast L3) 4932
118 5JCS 3 B 60S ribosomal protein L3 4932
119 5IT7 5 BB 60S ribosomal protein L3 28985
120 3JCT 2 B 60S ribosomal protein L3 4932
121 3JCS 10 B ribosomal protein L3 5661
122 5GAK 17 F 60S ribosomal protein L3 4932
123 5FL8 2 B 60S ribosomal protein L3 4932
124 5APN 5 B 60S ribosomal protein L3 4932
125 5APO 5 B 60S ribosomal protein L3 4932
126 3JBN 70 AE 60S ribosomal protein uL3 5833
127 3JBO 70 AE 60S ribosomal protein uL3 5833
128 3JBP 70 AE 60S ribosomal protein uL3 5833
129 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
130 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
131 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
132 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
133 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
134 3JAG 2 B uL3 9986
135 3JAH 2 B uL3 9986
136 3JAI 2 B uL3 9986
137 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
138 5AJ0 4 AB 60S ribosomal protein L3 9606
139 3J92 2 B uL3 9986
140 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
141 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
142 4V3P 80 LC Ribosomal protein L3 4565
143 3J7O 5 B Ribosomal protein uL3 9823
144 3J7P 5 B Ribosomal protein uL3 9823
145 3J7Q 5 B Ribosomal protein uL3 9823
146 3J7R 5 B Ribosomal protein uL3 9823
147 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
148 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
149 3J79 5 E 60S ribosomal protein uL3 5833
150 3J77 3 L3 60S ribosomal protein L3 4932
151 3J78 3 L3 60S ribosomal protein L3 4932
152 3J6X 6 L3 60S ribosomal protein L3 4932
153 3J6Y 6 L3 60S ribosomal protein L3 4932
154 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
155 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
156 4V7F 6 C 60S ribosomal protein L3 4932
157 4V7E 71 CB 60S ribosomal protein L3 4565
158 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
159 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
160 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
161 4V6W 63 CB 60S ribosomal protein L3 7227
162 4V6X 63 CB 60S ribosomal protein L3 9606
163 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
164 4V6U 33 BC 50S ribosomal protein L3P 2261
165 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
166 4ADX 12 B RPL3 145262
167 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
168 4V7H 27 BC 60S ribosomal protein L3 5541
169 4V5Z 54 Bb 60S Ribosomal protein L3 9612
170 4V4B 22 BC 60S ribosomal protein L3 4932
171 1ML5 29 e 50S RIBOSOMAL PROTEIN L3 562
172 4V42 29 BE 50S RIBOSOMAL PROTEIN L3 274