Sequence Similarity Clusters for the Entities in PDB 1EXR

Entity #1 | Chains: A
CALMODULIN protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 7 8865
95 % 1 7 8849 Flexibility: Low
Max RMSD: 2.5, Avg RMSD: 0.9
PDBFlex
90 % 1 203 77
70 % 1 205 93
50 % 1 238 106
40 % 1 361 41
30 % 1 432 42

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1EXR 1 A CALMODULIN 5888
2 5E1N 1 A Calmodulin 5888
3 5E1P 1 A Calmodulin 5888
4 5E1K 1 A Calmodulin 5888
5 2O5G 1 A Calmodulin 9031
6 4DJC 1 A Calmodulin 9606
7 3GOF 1 A, B Calmodulin 9031
8 3GP2 1 A Calmodulin 9031
9 4LZX 1 A Calmodulin UNP residues 2-149 9606
10 2W73 1 A, B, E, F CALMODULIN 9606
11 2F3Y 1 A Calmodulin 9606
12 5DOW 1 A, C, E, G Calmodulin 9606
13 4J9Y 2 R Calmodulin 10116
14 2O60 1 A Calmodulin 9031
15 5V03 2 R Calmodulin 9606
16 3IF7 1 A Calmodulin 9913
17 5NIN 1 A, B Calmodulin 9606
18 1QTX 1 A PROTEIN (CALMODULIN) 562
19 4G28 2 R Calmodulin 10116
20 4G27 2 R Calmodulin 10116
21 1G4Y 2 R CALMODULIN 10116
22 4J9Z 2 R Calmodulin 10116
23 2F3Z 1 A Calmodulin 9606
24 1PRW 1 A Calmodulin 9913
25 1OSA 1 A CALMODULIN 5888
26 5JQA 1 A Calmodulin 9606
27 1MXE 1 A, B Calmodulin 7227
28 1YR5 1 A calmodulin residues 1-148 9606
29 5JTH 1 A Calmodulin 9606
30 1CLL 1 A CALMODULIN 9606
31 5V02 2 R Calmodulin-1 9606
32 2WEL 2 D CALMODULIN 9606
33 1N0Y 1 A, B Calmodulin 5888
34 3BYA 1 A Calmodulin 9606
35 1VRK 1 A CALMODULIN 32630
36 3SJQ 1 A, B Calmodulin 10116
37 5K8Q 1 A Calmodulin 9606
38 4EHQ 1 A Calmodulin 10116
39 1CLM 1 A CALMODULIN 5888
40 4BW7 1 A, C CALMODULIN 9606
41 1AHR 1 A CALMODULIN 9031
42 1IQ5 1 A CALMODULIN 8355
43 5WBX 2 R Calmodulin-1 9606
44 1CM4 1 A CALMODULIN 9913
45 1ZUZ 1 A calmodulin 9606
46 1QS7 1 A, C CALMODULIN 562
47 2Y4V 1 A CALMODULIN 9606
48 2HQW 1 A Calmodulin 10116
49 5J03 2 B Calmodulin This is mammalian calmodulin with four bound Ca2+ ions. The initiating methionine residue is cleaved in vivo. 9606
50 3SUI 1 A Calmodulin 9606
51 1UP5 1 A, B Calmodulin 9031
52 4BW8 1 A, B CALMODULIN 9606
53 4QNH 2 R Calmodulin 10116
54 2R28 1 A, B Calmodulin Calmodulin-binding domain 9606
55 2VAY 1 A CALMODULIN RESIDUES 3-148 9606
56 4Q5U 1 A Calmodulin 9606
57 4AQR 1 A, B CALMODULIN-7 3702
58 2BE6 1 A, B, C Calmodulin 2 9606
59 1CDL 1 A, B, C, D CALMODULIN 9606
60 1CDM 1 A PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II 9913
61 4DBP 2 C Calmodulin 7227
62 4HEX 1 A, B Calmodulin 10090
63 4M1L 1 A Calmodulin UNP residues 2-149 9606
64 2BCX 1 A Calmodulin 9031
65 1LIN 1 A CALMODULIN 9913
66 3CLN 1 A CALMODULIN 10117
67 1IWQ 1 A CALMODULIN 9606
68 2V01 1 A CALMODULIN 9606
69 1WRZ 1 A calmodulin 9606
70 2YGG 2 B CALMODULIN 10116
71 1RFJ 1 A calmodulin 4113
72 3L9I 2 C Calmodulin 7227
73 1CM1 1 A CALMODULIN 9913
74 1NIW 1 A, C, E, G calmodulin 10116
75 4CLN 1 A CALMODULIN 7227
76 3G43 1 A, B, C, D Calmodulin 9606
77 1XA5 1 A Calmodulin 9913
78 1OOJ 1 A Calmodulin CMD-1 6239
79 2X0G 2 B CALMODULIN 9606
80 5A2H 1 A CALMODULIN HELIX-LOOP-HELIX 3702
81 6B8P 2 B, D, F, H Calmodulin-1 9606
82 4DCK 2 B Calmodulin Calmodulin 9606
83 4PJJ 2 B Calmodulin 7227
84 4L79 2 B Calmodulin 9606
85 4UPU 1 A CALMODULIN RESIDUES 2-149 9606
86 5WC5 2 R Calmodulin-1 9606
87 2X51 2 B CALMODULIN 7227
88 6B8N 2 B, D, F, H Calmodulin-1 9606
89 6B8L 2 B, D, F, H Calmodulin-1 9606
90 3BXL 1 A Calmodulin 10116
91 2VB6 2 B CALMODULIN 9031
92 5DBR 1 A Calmodulin 9606
93 3DVE 1 A Calmodulin 9606
94 4DBQ 2 B Calmodulin 7227
95 2BKH 2 B CALMODULIN 7227
96 2V02 1 A CALMODULIN 9606
97 6B8M 2 B, D, F, H Calmodulin-1 9606
98 1QIW 1 A, B CALMODULIN 9913
99 4ZLK 2 B Calmodulin 10090
100 5WSV 1 A, C Calmodulin UNP residues 1-147 9606
101 3EWT 1 A Calmodulin 9606
102 2VAS 2 B CALMODULIN 7227
103 1Y6W 1 A Calmodulin 9606
104 1CTR 1 A CALMODULIN 9606
105 1L7Z 1 A CALMODULIN 9606
106 2IX7 1 A, B CALMODULIN APO-CALMODULIN RESIDUES 2-146 10090
107 4BYF 2 B, D CALMODULIN 9606
108 3DVK 1 A Calmodulin 9606
109 3BXK 1 A, C Calmodulin 10116
110 1QIV 1 A CALMODULIN 9913
111 1A29 1 A CALMODULIN 9913
112 1QX5 1 B, D, I, J, K, R, T, Y Calmodulin 10116
113 2FOT 1 A Calmodulin 9913
114 3HR4 2 B, D, F, H Calmodulin 9606
115 6B8Q 2 B, D, F, H Calmodulin-1 9606
116 3GN4 2 B, D, F, H Calmodulin 7227
117 3EWV 1 A Calmodulin 9606
118 3OXQ 1 A, B, C, D Calmodulin 9606
119 1K90 2 D, E, F CALMODULIN 9606
120 4GOW 1 D Calmodulin 9606
121 4ANJ 2 B CALMODULIN 7227
122 4OVN 1 A, B, C, D, E Calmodulin 9606
123 5HIT 1 A Calmodulin 9031
124 5V7X 2 B Calmodulin-1 9606
125 5I0I 2 C Calmodulin 9606
126 5I0I 3 E Calmodulin 9606
127 4V0C 2 C, D CALMODULIN RESIDUES 1-149 9606
128 4UMO 2 C, D CALMODULIN 9606
129 4JPZ 3 C, I Calmodulin 9606
130 1DEG 1 A CALMODULIN 9913
131 3DVJ 1 A Calmodulin 9606
132 3DVM 1 A Calmodulin 9606
133 5WSU 1 A, B Calmodulin UNP residues 2-149 9606
134 2BKI 2 B, D CALMODULIN 9031
135 1S26 2 D, E, F Calmodulin 9606
136 1SK6 2 D, E, F Calmodulin 9606
137 1K93 2 D, E, F CALMODULIN 9606
138 1XFX 2 O, P, Q, R, S, T Calmodulin 2 9606
139 1XFZ 2 O, P, Q, R, S, T Calmodulin 2 9606
140 4R8G 2 A, B, H Calmodulin 8355
141 1PK0 2 D, E, F Calmodulin 9606
142 1QX7 1 A, B, I, M, R Calmodulin 10116
143 1XFV 2 O, P, Q, R, S, T Calmodulin 2 9606
144 1XFY 2 O, P, Q, R, S, T Calmodulin 2 9606
145 1XFW 2 O, P, Q, R, S, T Calmodulin 2 9606
146 1XFU 2 O, P, Q, R, S, T Calmodulin 2 9606
147 4JQ0 2 C Calmodulin 9606
148 1LVC 2 D, E, F calmodulin 9606
149 1Y0V 2 H, I, J, K, L, M Calmodulin 8355
150 6CNM 2 E, F, G, H Calmodulin-1 9606
151 6CNN 2 E, F, G, H Calmodulin-1 9606
152 6CNO 2 E, F, G, H Calmodulin-1 9606
153 6C1D 3 R Calmodulin 32644
154 6C1G 2 R Calmodulin 32644
155 6C1H 3 R Calmodulin 32644
156 6FEG 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
157 6FEH 2 B Calmodulin-1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 9606
158 6BNV 3 O, P, Q, R, S, T Calmodulin 9031
159 5OEO 1 A Calmodulin-1 9606
160 5VMS 2 B Calmodulin 9606
161 5TP5 1 A Calmodulin 9606
162 5TP6 1 A Calmodulin 9606
163 5T0X 1 A Calmodulin 8355
164 5SY1 1 C, D Calmodulin 7108
165 5GGM 1 A Calmodulin 9606
166 5K7L 2 B Calmodulin 9606
167 5J8H 1 A Calmodulin 9606
168 5J7J 1 A Calmodulin Xenopus laevis Calmodulin 8355
169 2N8J 1 A Calmodulin 9606
170 2N27 1 A Calmodulin UNP residues 2-149 9606
171 2MGU 1 A Calmodulin 10116
172 2MG5 1 A Calmodulin UNP residues 2-149 9606
173 2MES 1 A Calmodulin 8355
174 3J41 2 E, F Calmodulin 9606
175 2M55 1 A Calmodulin 9606
176 2M3S 1 A Calmodulin UNP residues 1-149 9031
177 2M0J 1 A Calmodulin 9606
178 2M0K 1 A Calmodulin 9606
179 2LV6 1 A Calmodulin 9606
180 2LL6 1 A Calmodulin 9606
181 2LL7 1 A Calmodulin 9606
182 2LGF 1 A Calmodulin sequence database residues 4-149 9606
183 2L7L 1 A Calmodulin 9606
184 2L53 1 A Calmodulin calmodulin 9606
185 2KNE 1 A Calmodulin 9606
186 2KDU 1 A Calmodulin 8355
187 2K61 1 A Calmodulin 9606
188 2K0J 1 A calmodulin 9606
189 2K0E 1 A Calmodulin 9606
190 2K0F 1 A calmodulin 9606
191 2JZI 1 A Calmodulin 9606
192 2DFS 2 B, C, D, E, F, G, N, O, P, Q, R, S Calmodulin 10090
193 1X02 1 A calmodulin 8355
194 1SY9 1 A CALMODULIN 8355
195 1NWD 1 A Calmodulin 8355
196 1CFF 1 A PROTEIN (CALMODULIN) 8355
197 1CKK 1 A Calmodulin-1 8355
198 1MUX 1 A CALMODULIN 8355
199 1DMO 1 A CALMODULIN 8355
200 1CFD 1 A CALMODULIN 8355
201 1CFC 1 A CALMODULIN 8355
202 2BBM 1 A CALMODULIN 7227
203 2BBN 1 A CALMODULIN 7227