Sequence Similarity Clusters for the Entities in PDB 1ERE

Entity #1 | Chains: A,B,C,D,E,F
ESTROGEN RECEPTOR protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 221 223 49
95 % 269 273 33 Flexibility: Low
Max RMSD: 7.3, Avg RMSD: 1.5
PDBFlex
90 % 269 273 36
70 % 269 273 48
50 % 302 309 68
40 % 323 331 60
30 % 1247 1308 8

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4PF3 1 A Mineralocorticoid receptor UNP residues 716-988 9606
2 1YMT 1 A Steroidogenic factor 1 mSF-1 LBD (residues 219-462) 10090
3 1FCY 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH CD564, RESIDUE 564 LIGAND BINDING DOMAIN 9606
4 3VHV 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 727-984 9606
5 1FD0 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH SR11254, RESIDUE 254 LIGAND BINDING DOMAIN 9606
6 1FCZ 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH BMS181156, RESIDUE 156 LIGAND BINDING DOMAIN 9606
7 3B0T 1 A Vitamin D3 receptor vitamin D receptor binding domain 9606
8 1FCX 1 A RETINOIC ACID RECEPTOR GAMMA-1 COMPLEXED WITH BMS184394, RESIDUE 184 LIGAND BINDING DOMAIN 9606
9 3WFG 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
10 4OHA 1 A Androgen receptor ligand binding doamin 9606
11 3A40 1 X Vitamin D3 receptor Ligand Binding Domain, UNP residues 118-427 9606
12 5V8Q 1 A Androgen receptor UNP residues 140-388 9606
13 1T7R 1 A Androgen receptor ligand binding domain 9598
14 3AZ3 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
15 1SR7 1 A, B Progesterone receptor Ligand binding domain 9606
16 3CJW 1 A COUP transcription factor 2 ligand binding domain, residues 173-412 9606
17 5U3Q 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
18 1SQN 1 A, B progesterone receptor residues 676-933, ligand binding domain 9606
19 1IE9 1 A VITAMIN D3 RECEPTOR 9606
20 3OLL 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
21 5DXE 1 A, B Estrogen receptor 9606
22 3VTC 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
23 3MNP 1 A Glucocorticoid receptor UNP residues 527-783 10090
24 3MNO 1 A Glucocorticoid receptor UNP residues 527-783 10090
25 3U9Q 1 A Peroxisome proliferator-activated receptor gamma Ligand Binding Domain, UNP residues 236-504 9606
26 3AZ1 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
27 1NQ7 1 A NUCLEAR RECEPTOR ROR-BETA LIGAND-BINDING DOMAIN 10116
28 3L3X 1 A Androgen receptor 9606
29 3UUD 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
30 3UUD 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
31 2E2R 1 A Estrogen-related receptor gamma ligand binding domain, residues 232-459 9606
32 5UFW 1 A, B Estrogen receptor 9606
33 5UFX 1 A, B Estrogen receptor 9606
34 1IE8 1 A VITAMIN D3 RECEPTOR 9606
35 1YP0 1 A nuclear receptor subfamily 5, group A, member 1 ligand binding domain (Residues: 223-461) 10090
36 3ZR7 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 9606
37 1XPC 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
38 5KCT 1 A, B Estrogen receptor ligand-binding domain 9606
39 5W9D 1 A, B Estrogen receptor 9606
40 5APH 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
41 1T7M 1 A Androgen receptor ligand binding domain 9598
42 1T7F 1 A Androgen receptor ligand binding domain 9598
43 2PNU 1 A Androgen receptor ligand binding domain 9606
44 6CBZ 1 A Estrogen receptor 9606
45 6CBZ 2 B Estrogen receptor 9606
46 3VT7 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
47 2AX6 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
48 1EXA 1 A RETINOIC ACID RECEPTOR GAMMA-2 LIGAND BINDING DOMAIN 9606
49 1EXX 1 A RETINOIC ACID RECEPTOR GAMMA-2 LIGAND BINDING DOMAIN 9606
50 2IOG 1 A Estrogen receptor Steroid-binding region, residues 306-554 9606
51 5U42 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
52 5MKU 1 A Retinoic acid receptor RXR-alpha 9606
53 3TKC 1 A Vitamin D3 receptor 9606
54 1N83 1 A Nuclear receptor ROR-alpha Ligand Binding Domain, residues 304-556 9606
55 1XP6 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
56 2AM9 1 A Androgen receptor ligand binding domain 9606
57 4QE6 1 A Bile acid receptor unp residues 258-486 9606
58 3OGT 1 A Vitamin D3 receptor 9606
59 5NTW 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
60 2GPU 1 A Estrogen-related receptor gamma Ligand Binding Domain (Residues 229-458) 9606
61 3B1M 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
62 5U3Z 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
63 1T7T 1 A Androgen receptor ligand binding domain 9598
64 5U3T 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
65 4WLB 1 A, B Nuclear receptor ROR-gamma ROR-gamma ligand binding domain 9606
66 2QXS 1 A, B Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
67 3V49 1 A Androgen receptor unp residues 654-919 9606
68 3A3Z 1 X Vitamin D3 receptor Ligand Binding Domain, UNP residues 118-427 9606
69 3V9T 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
70 2QZO 1 A Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
71 2QZO 2 B Estrogen receptor STEROID-BINDING REGION, RESIDUES 298-554 9606
72 5Q0I 1 A Bile acid receptor UNP residues 258-486 9606
73 3P8X 1 A Vitamin D3 receptor Ligand binding domain 9606
74 3V9V 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
75 4ONI 1 A, B Nuclear receptor subfamily 5 group A member 2 Ligand Binding Domain, UNP residues 291-541 9606
76 1G2N 1 A ULTRASPIRACLE PROTEIN LIGAND BINDING DOMAIN 7102
77 3AZ2 1 A Vitamin D3 receptor fusion protein of residues 120-164 and residues 216-423 UNP RESIDUES 120-164, 216-423 9606
78 5M24 1 A Retinoic acid receptor gamma UNP residues 178-423 9606
79 5G42 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
80 5Y2T 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
81 5NTP 1 A Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
82 3B66 1 A Androgen receptor residues 671-919 9606
83 2ZKC 1 A Estrogen-related receptor gamma ligand binding domain, UNP residues 222-459 9606
84 3ILZ 1 A Thyroid hormone receptor, alpha isoform 1 variant 9606
85 4CI5 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 206-477 9606
86 6G07 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
87 2AAX 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
88 3VT3 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
89 4ZNV 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
90 3L0L 1 A, B Nuclear receptor ROR-gamma RORgamma 9606
91 2H79 1 A THRA protein 9606
92 3PLZ 1 A, B FTZ-F1 related protein UNP residues 300-541 9606
93 5Y7X 1 A, B Peroxisome proliferator-activated receptor delta UNP residues 171-441 9606
94 2AX9 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
95 4PLD 1 A Nuclear receptor subfamily 5 group A member 2 UNP residues 301-541 9606
96 5G46 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
97 6CHZ 1 A Estrogen receptor 9606
98 4OIV 1 A, B Bile acid receptor UNP RESIDUES 258-483 9606
99 5FQV 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
100 5WGD 1 A, B Estrogen receptor 9606
101 2AMB 1 A Androgen receptor ligand binding domain 9606
102 5KD9 1 A, B Estrogen receptor ligand-binding domain 9606
103 2ZMI 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
104 2AX8 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
105 1XP1 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
106 2Q7K 1 A Androgen receptor 9606
107 5M96 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain, UNP residues 263-491 9606
108 4TV1 1 A Estrogen receptor Residues 302-552 9606
109 4TV1 2 B Estrogen receptor Residues 302-552 9606
110 5HJS 1 A, B Oxysterols receptor LXR-alpha 9606
111 3ZRB 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 678-933 9606
112 5KCD 1 A, B Estrogen receptor ligand-binding domain 9606
113 2J7Y 1 A ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 255-509 10116
114 2QSE 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
115 5DXG 1 A, B Estrogen receptor 9606
116 2W8Y 1 A, B PROGESTERONE RECEPTOR PR LBD, RESIDUES 678-933 9606
117 1XP9 1 A Estrogen receptor LIGAND BINDING DOMAIN 9606
118 5C4T 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
119 2HB7 1 A Vitamin D3 receptor Ligand binding domain 9606
120 5U2D 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
121 4LNW 1 A Thyroid hormone receptor alpha 9606
122 4RWV 1 A Nuclear receptor subfamily 5 group A member 2 LIGAND BINDING DOMAIN (UNP residues 294-551) 9606
123 1A28 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN 9606
124 3W0H 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-164, 212-420 10116
125 1DB1 1 A VITAMIN D NUCLEAR RECEPTOR LIGAND BINDING DOMAIN 9606
126 3CS6 1 A Vitamin D3 receptor UNP residues 118-427 9606
127 5U3W 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
128 3WT5 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
129 5TN4 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
130 3W0A 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
131 4G2I 1 A Vitamin D3 receptor unp residues 118-417 9606
132 2Q7I 1 A Androgen receptor 9606
133 4MG8 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
134 4MG8 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
135 2P1T 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
136 3MNE 1 A Glucocorticoid receptor UNP residues 527-783 10090
137 3VI8 1 A Peroxisome proliferator-activated receptor alpha Ligand binding domain 9606
138 4MGA 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
139 4MGA 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
140 3KMR 1 A Retinoic acid receptor alpha ligand binding domain (UNP RESIDUE 176-421) 9606
141 5Z6S 1 A Peroxisome proliferator-activated receptor gamma 9606
142 4PLE 1 A, C, E, G Nuclear receptor subfamily 5 group A member 2 UNP residues 301-541 9606
143 2B1Z 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
144 5W9C 1 A, B, C, D Estrogen receptor 9606
145 1T79 1 A Androgen receptor ligand binding domain 9598
146 5NIB 1 A Nuclear receptor ROR-gamma 9606
147 2P54 1 A Peroxisome proliferator-activated receptor alpha PPAR alpha 9606
148 5GT4 1 A Vitamin D3 receptor UNP RESIDUES 118-164,216-423 9606
149 3AUN 1 A Vitamin D3 receptor ligand binding domain 10116
150 2P15 1 A, B Estrogen receptor Ligand Binding Domain (residues 298-554) 9606
151 5G44 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
152 5Q13 1 A, C Bile acid receptor 9606
153 3RLL 1 A Androgen receptor Ligand binding domain residues 671-917 9606
154 3A78 1 A Vitamin D3 receptor Ligand Binding Domain 9606
155 5Y2O 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
156 2ZBS 1 A Estrogen-related receptor gamma ligand binding domain, residues 222-459 9606
157 5Z5S 1 A Peroxisome proliferator-activated receptor gamma 9606
158 5Q1E 1 A Bile acid receptor 9606
159 4WQP 1 A, B Nuclear receptor ROR-gamma ROR-gamma ligand binding domain 9606
160 4S15 1 A, B Nuclear receptor ROR-alpha ligand-binding domain 9606
161 4DOR 1 A, B Nuclear receptor subfamily 5 group A member 2 UNP residues 290-541 9606
162 5AAU 1 A, B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
163 2B1V 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
164 1T65 1 A Androgen receptor AR Ligand Binding Domain 669-919 9606
165 4OEY 1 A Androgen receptor ligand binding domain 9606
166 2YJA 2 B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 299-551 9606
167 3L03 1 A, B Estrogen receptor UNP residues 298-550 9606
168 5TLT 1 A, B Estrogen receptor ligand-binding domain 9606
169 2PIT 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
170 5DZI 1 A, B Estrogen receptor ligand-binding domain 9606
171 4TUZ 1 A Estrogen receptor Residues 302-552 9606
172 4TUZ 2 B Estrogen receptor Residues 302-552 9606
173 5KCE 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
174 4ZSH 1 A Retinoic acid receptor RXR-alpha Ligand binding domain residues 223 - 462 9606
175 2AXA 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
176 1XOW 1 A androgen receptor inhibited by r1881 ligand binding domain 9606
177 4PXM 1 A, B Estrogen receptor D538G 9606
178 2Q7J 1 A Androgen receptor 9606
179 5K13 1 A Retinoic acid receptor alpha UNP residues 176-421 9606
180 2AB2 1 A, B Mineralocorticoid receptor MR Ligand Binding Domain 9606
181 4IWF 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
182 5Q0K 1 A Bile acid receptor UNP residues 258-486 9606
183 4UDD 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, UNP RESIDUES 500-777 9606
184 5U3V 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
185 3V4A 1 A Androgen receptor unp residues 671-919 9606
186 1QKM 1 A ESTROGEN RECEPTOR BETA COMPLEXED WITH THE PHYTO-OESTROGEN GENISTEIN LIGAND-BINDING DOMAIN 9606
187 4PPS 1 A, B Estrogen receptor ligand-binding domain (UNP residues 305-548) 9606
188 2HAM 1 A Vitamin D3 receptor Ligand binding domain 9606
189 5L11 1 A Nuclear receptor subfamily 5 group A member 2 unp residues 299-541 9606
190 5B41 1 A Vitamin D3 receptor deletion mutant, residues 165-211 UNP RESIDUES 116-164, 212-423 10116
191 6FZU 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
192 3X36 1 A Vitamin D3 receptor ligand binding domain (UNP residues 118-164, 216-427) 9606
193 5U43 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
194 2Q7L 1 A Androgen receptor 9606
195 1YIM 1 A Estrogen receptor LIGAND BINDING DOMAIN, residues 307-554 9606
196 1TXI 1 A Vitamin D receptor ligand binding domain 9606
197 5GTN 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
198 3E94 1 A Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
199 2HAR 1 A Vitamin D3 receptor Ligand binding domain 9606
200 5Q0O 1 A, C Bile acid receptor 9606
201 5HYK 1 A Peroxisome proliferator-activated receptor alpha 9606
202 1Z95 1 A Androgen Receptor LIGAND BINDING DOMAIN 9606
203 4ZNS 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
204 5KCW 1 A, B Estrogen receptor ligand-binding domain 9606
205 3RY9 1 A, B Ancestral Glucocorticoid Receptor 1 ligand binding domain 32630
206 5Q0P 1 A, C Bile acid receptor 9606
207 4OEZ 1 A Androgen receptor ligand binding domain 9606
208 1MZN 1 A, C, E, G RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
209 3WGP 1 A Vitamin D3 receptor UNP residues 120-423 9606
210 2XKW 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 204-477 9606
211 4MGB 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
212 4MGB 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
213 3ET3 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
214 2GPO 1 A Estrogen-related receptor gamma Ligand Binding Domain (Residues 229-458) 9606
215 4LNX 1 A Thyroid hormone receptor alpha UNP P10827 residues 148-370, UNP Q6LDR0 residues 36-75 9606
216 5FQS 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
217 5Q0U 1 A, C Bile acid receptor 9606
218 6ESN 1 A Nuclear receptor ROR-gamma 9606
219 4ZNT 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
220 5MJ5 1 A Retinoic acid receptor RXR-alpha 9606
221 3W0Y 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
222 4MGD 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
223 4MGD 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
224 4JYI 1 A, B Retinoic acid receptor beta Ligand binding domain, UNP residues 176-421 9606
225 6CHW 1 A Estrogen receptor 9606
226 5Q14 1 A, C Bile acid receptor 9606
227 2QA8 1 A Estrogen receptor Steroid-binding region, residues 298-554 9606
228 2QA8 2 B Estrogen receptor Steroid-binding region, residues 298-554 9606
229 5MK4 1 A, C Retinoic acid receptor RXR-alpha UNP residues 229-457 9606
230 4Y29 1 A Peroxisome proliferator-activated receptor gamma UNP residues 236-504 9606
231 3W0C 1 A Vitamin D3 receptor FUSION PROTEIN OF RESIDUES 120-164 AND RESIDUES 216-423 UNP RESIDUES 120-164, 216-423 9606
232 3JZB 1 A THRA protein UNP residues 148-410, Ligand Binding Domain 9606
233 1MV9 1 A RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
234 1MVC 1 A RXR retinoid X receptor ligand binding domain(residues 223-462) 9606
235 5NTN 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
236 5E1C 1 A, B Estrogen receptor ligand-binding domain 9606
237 1ZGY 1 A Peroxisome proliferator activated receptor gamma PPARgamma Ligand Binding Domain 9606
238 5U46 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
239 3WJ5 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
240 3W0I 1 A Vitamin D3 Receptor LIGAND BINDING DOMAIN, UNP residues 121-159, 218-420 10116
241 3BEJ 1 A, B Bile acid receptor residues 249-486 9606
242 5U3R 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
243 3B5R 1 A Androgen receptor residues 671-919 9606
244 3G8O 1 A, B Progesterone receptor ligand binding domain 9606
245 2HAS 1 A Vitamin D3 receptor ligand binding domain 9606
246 5U3Y 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
247 5FQP 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP 307-554 9606
248 1OSH 1 A Bile acid receptor Ligand Binding Domain 9606
249 4IW6 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
250 5Q1D 1 A, C Bile acid receptor 9606
251 5U45 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
252 3OMK 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
253 4DM6 1 A, B Retinoic acid receptor beta unp residues 176-421 9606
254 2AX7 1 A Androgen receptor Ligand Binding Domain (residues 663-918) 9606
255 3OLF 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
256 5TN5 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
257 5DWE 1 A, B Estrogen receptor ligand-binding domain 9606
258 2Q1H 1 A AncCR 32644
259 4OKW 1 A Androgen receptor ligand binding doamin 9606
260 1ZUC 1 A, B Progesterone receptor 9606
261 4APU 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 514-769 9606
262 3W0J 1 A Vitamin D3 Receptor LIGAND BINDING DOMAIN, UNP residues 121-164, 212-420 10116
263 4ZN7 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
264 3LMP 1 A Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
265 5UC3 1 A, B Glucocorticoid receptor UNP residues 522-777 9606
266 5FQR 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
267 5Q0V 1 A, C Bile acid receptor 9606
268 5B5B 1 A, D Vitamin D3 receptor UNP RESIDUES 116-164, 212-423 10116
269 4RMD 1 A Retinoic acid receptor RXR-alpha ligand binding domain 228-458 9606
270 4MG9 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
271 4MG9 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
272 3WJ4 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
273 4X1F 1 A Nuclear receptor subfamily 1 group I member 2 UNP residues 130-434 9606
274 5Q0W 1 A Bile acid receptor 9606
275 2AA6 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
276 2PIP 1 L Androgen receptor Ligand-binding domain (residues 669-919) 9606
277 5VB3 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
278 3VRV 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
279 5AAV 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN 9606
280 5AAV 2 B ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN 9606
281 4RZF 1 A, B Nuclear receptor subfamily 4 group A member 1 Nur77-LBD 9606
282 5U41 1 A, B Peroxisome proliferator-activated receptor delta UNP RESIDUES 131-402 9606
283 5Q0R 1 A Bile acid receptor 9606
284 3M7R 1 A Vitamin D3 receptor VDR, UNP residues 120-423 9606
285 3VT4 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
286 5Q12 1 A Bile acid receptor 9606
287 3CS4 1 A Vitamin D3 receptor UNP residues 118-427 9606
288 3B65 1 A Androgen receptor residues 671-919 9606
289 4Q0A 1 C Vitamin D3 receptor A Ligand binding domain 7955
290 5SYZ 1 A Nuclear receptor subfamily 5 group A member 2 9606
291 5Q1I 1 A Bile acid receptor 9606
292 5ACC 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
293 3ZRA 1 A, B PROGESTERONE RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 678-933 9606
294 3TKM 1 A Peroxisome proliferator-activated receptor delta LBD, UNP residues 171-441 9606
295 4ZNH 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
296 5Q18 1 A, C Bile acid receptor 9606
297 2AMA 1 A Androgen receptor ligand binding domain 9606
298 5XZF 1 A Vitamin D3 receptor UNP residues 116-423 10116
299 2HB8 1 A Vitamin D3 receptor Ligand binding domain 9606
300 3G0W 1 A Androgen receptor Ligand-binding domain 10116
301 2BJ4 1 A ESTROGEN RECEPTOR RESIDUES 305-533 (LIGAND-BINDING DOMAIN) 9606
302 2BJ4 2 B ESTROGEN RECEPTOR RESIDUES 305-533 (LIGAND-BINDING DOMAIN) 9606
303 5TM8 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
304 2ZL9 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
305 2FVJ 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, RESIDUES 207-477 9606
306 5JI0 1 A Retinoic acid receptor RXR-alpha 9606
307 5JI0 2 D Peroxisome proliferator-activated receptor gamma 9606
308 5TN1 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
309 5NTK 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
310 1L2I 1 A, B ESTROGEN RECEPTOR ligand-binding domain (residues 297-554) 9606
311 4DOS 1 A Nuclear receptor subfamily 5 group A member 2 Ligand Binding Domain, UNP residues 299-538 9606
312 5UNJ 1 A Nuclear receptor subfamily 5 group A member 2 unp residues 299-541 9606
313 1YUC 1 A, B Orphan nuclear receptor NR5A2 Ligand Binding Domain 9606
314 2AO6 1 A androgen receptor INHIBITED BY R1881 LIGAND BINDING DOMAIN 9606
315 5U3S 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
316 2POG 1 A, B Estrogen receptor ligand binding domain (residues 304-551) 9606
317 4OJB 1 A Androgen receptor ligand binding doamin 9606
318 1SJ0 1 A Estrogen receptor Ligand Binding Domain 9606
319 5TWO 1 A Peroxisome proliferator-activated receptor gamma lignad binding domain (UNP residues 234-505) 9606
320 5JMM 1 A Estrogen receptor 9606
321 5JMM 2 B Estrogen receptor 9606
322 5YSY 1 A Vitamin D3 receptor ligand binding domain 9606
323 3GZ9 1 A Peroxisome proliferator-activated receptor delta Ligand Binding Domain (residues 207-475) 9606
324 1GS4 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 670-917 9606
325 5FQT 1 A ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN, UNP RESIDUES 307-554 9606
326 3FLI 1 A Bile acid receptor Ligand Binding Domain 9606
327 4LTW 1 A Ancestral Steroid Receptor 2
328 5YT2 1 A Vitamin D3 receptor ligand binding domain 9606
329 2Q1V 1 A AncCR 32644
330 5U40 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
331 4UDA 1 A MINERALOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 735-984 9606
332 3RLJ 1 A Androgen receptor Ligand-binding domain residues 671-917 9606
333 5E0W 1 A, B Estrogen receptor ligand-binding domain 9606
334 5NU1 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
335 3OS8 1 A, B Estrogen receptor 9606
336 3OS8 2 C, D Estrogen receptor 9606
337 5Y1J 1 A Bile acid receptor UNP residues 244-471 9606
338 3L3Z 1 A Androgen receptor ligand binding domain 9606
339 5MX7 1 A1 Vitamin D3 receptor A UNP residues 156-453 7955
340 5XZH 1 A Vitamin D3 receptor UNP residues 116-423 10116
341 2QAB 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
342 3KBA 1 A, B Progesterone receptor Steroid-binding region: UNP residues 681-933 9606
343 5Q0J 1 A, C Bile acid receptor UNP residues 258-486 9606
344 2OZ7 1 A Androgen receptor residues 671-919 9606
345 1K4W 1 A Nuclear receptor ROR-beta ligand-binding domain 10116
346 5VB6 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
347 3KDU 1 A, B Peroxisome proliferator-activated receptor alpha Ligand-binding domain: UNP residues 196-468 9606
348 5K38 1 A, B Nuclear receptor ROR-gamma ligand binding domain 9606
349 6G05 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
350 5DXB 1 A Estrogen receptor 9606
351 5DXB 2 B Estrogen receptor 9606
352 3KMZ 1 A, B Retinoic acid receptor alpha ligand binding domain 9606
353 2B50 1 A, B Peroxisome proliferator activated receptor delta residues 205-476 9606
354 4P6W 1 A Glucocorticoid receptor Ligand binding domain (UNP residues 526-777) 9606
355 4IVY 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
356 3B67 1 A Androgen receptor residues 671-919 9606
357 5XPN 1 A Vitamin D3 receptor UNP residues 116-423 10116
358 3WFF 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
359 2OVH 1 A Progesterone receptor PR LBD 9606
360 4YMQ 1 A Nuclear receptor ROR-gamma Human RORgt ligand binding domain with N-terminal His6-Thrombin tag and a C-terminal linked SRC2 peptide via a GGG linker UNP residues 260-507 9606
361 3WT6 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
362 3OMQ 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
363 5DY8 1 A, B Estrogen receptor ligand-binding domain 9606
364 4N8R 1 A, B, C, D Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
365 3W0G 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 121-164, 212-420 10116
366 4ZI1 1 A Estrogen receptor beta LIGAND BINDING DOMAIN, UNP residues 262-509 9606
367 3IPQ 1 A Oxysterols receptor LXR-alpha Ligand binding domain: UNP residues 182-447 9606
368 3PCU 1 A Retinoic acid receptor RXR-alpha UNP residues 229-458 9606
369 5XPL 1 A Vitamin D3 receptor UNP residues 116-423 10116
370 2AA2 1 A Mineralocorticoid receptor 9606
371 4F9M 1 A Peroxisome proliferator-activated receptor gamma Ligand binding domain, UNP residues 234-505 9606
372 3KPZ 1 A Vitamin D3 receptor Ligand binding domain, residues 118-427 9606
373 4OH5 1 A Androgen receptor ligand binding domain 9606
374 2OUZ 1 A Estrogen receptor Ligand Binding Domain, residues 306-551 9606
375 4IVW 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
376 4MG6 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
377 3ERT 1 A PROTEIN (ESTROGEN RECEPTOR ALPHA) LIGAND-BINDING DOMAIN 9606
378 1S19 1 A Vitamin D3 receptor VDR ligand binding domain 9606
379 5YCP 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
380 3ERD 1 A, B ESTROGEN RECEPTOR ALPHA LIGAND-BINDING DOMAIN 9606
381 3UUA 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
382 3UUA 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
383 5DRJ 1 A, B Estrogen receptor 9606
384 5DWJ 1 A, B Estrogen receptor ligand-binding domain 9606
385 5E0X 1 A, B Estrogen receptor ligand-binding domain 9606
386 2AYR 1 A Estrogen receptor ligand binding domain, residues 304-551 9606
387 4A4W 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
388 2JF9 1 A, B, C ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 304-533 9606
389 5KCU 1 A, B Estrogen receptor ligand-binding domain 9606
390 5Q15 1 A, C Bile acid receptor 9606
391 5UGM 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
392 2ZFX 1 A Vitamin D3 receptor ligand binding domain 10116
393 5CJ6 1 A Androgen receptor Ligand Binding Domain (UNP residues 641-919) 9606
394 4A2J 1 A, B PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 514-769 9606
395 3CTB 1 A, B Pregnane X receptor, Linker, Steroid receptor coactivator 1 PXR, residues 130-434, linker, SRC-1, residues 678-700 9606 2.3.1.48 | Details
396 2YFE 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
397 3FUG 1 A Retinoic acid receptor RXR-alpha LIGAND BINDING DOMAIN (RESIDUES 223-462) 9606
398 3W5Q 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
399 3B68 1 A Androgen receptor RESIDUES 671-919 9606
400 5TNB 1 A, B, C, D Estrogen receptor ligand-binding domain 9606
401 5Q1A 1 A, C Bile acid receptor 9606
402 5Q1G 1 A Bile acid receptor 9606
403 2YJD 1 A, B ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 261-500 9606
404 3FEJ 1 A Peroxisome proliferator-activated receptor gamma PPAR gamma ligand binding domain 9606
405 2IHQ 1 A Androgen receptor LIGAND-BINDING DOMAIN 10116
406 2HFP 1 A Peroxisome proliferator-activated receptor gamma Ligand Binding Domain (residues 234-505) 9606
407 2A3I 1 A Mineralocorticoid receptor Mineralocoricoid receptor 9606
408 5TLP 1 A, B Estrogen receptor ligand-binding domain 9606
409 5X8U 1 A Uncharacterized protein UNP residues 248-505 61853
410 5KCF 1 A, B Estrogen receptor ligand-binding domain 9606
411 5T1Z 1 A, B Estrogen receptor 9606
412 5DL4 1 A, B Estrogen receptor ligand-binding domain 9606
413 3Q95 1 A Estrogen receptor Ligand Binding Domain residues 298-554 9606
414 3Q95 2 B Estrogen receptor LXXLL motif 2 residues 686-698 9606
415 5Q19 1 A, C Bile acid receptor 9606
416 5DZH 1 A, B Estrogen receptor ligand-binding domain 9606
417 2Q5S 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
418 4MG5 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
419 4A4V 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN, RESIDUES 195-477 9606
420 3W5P 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
421 4NIE 1 A, B Nuclear receptor ROR-gamma ligand binding domain, UNP residues 263-509 9606
422 2R6W 1 A, B Estrogen receptor ligand binding domain, UNP residues 304-551 9606
423 2ZAS 1 A Estrogen-related receptor gamma ligand binding domain, UNP residues 222-459 9606
424 2R6Y 1 A, B Estrogen receptor ligand binding domain, UNP RESIDUES 304-551 9606
425 3VT8 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
426 4IV2 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
427 3K6P 1 A Steroid hormone receptor ERR1 ligand binding domain 9606
428 4PP5 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
429 2ZLA 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
430 5OW7 1 A Vitamin D3 receptor A 7955
431 3OMP 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
432 3V3E 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
433 4REF 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
434 3VJS 1 A Vitamin D3 receptor ligand-binding domain, UNP residues 116-423 10116
435 5NFP 1 A Glucocorticoid receptor 9606
436 4PP6 1 A, B Estrogen receptor ligand-binding domain (UNP residues 305-548) 9606
437 5XMX 1 A, B Peroxisome proliferator-activated receptor delta UNP residues 171-441 9606
438 4J24 1 A, B, C, D Estrogen receptor beta Ligand Binding Domain, UNP residue 261-500' 9606
439 2J7X 1 A ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 255-509 10116
440 3OAP 1 A Retinoic acid receptor RXR-alpha hRXRalpha-LBD, UNP residues 228-458 9606
441 3AFR 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
442 2QR9 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
443 1T74 1 A Androgen receptor ligand binding domain 9598
444 1NRL 1 A, B Orphan nuclear receptor PXR Ligand Binding Domain 9606
445 5TN6 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
446 2ZNN 1 A Peroxisome proliferator-activated receptor alpha Ligand binding domain 9606
447 3FC6 1 A, C Retinoic acid receptor RXR-alpha 9606
448 3FC6 2 B, D Nr1h3 protein 10090
449 1T63 1 A Androgen receptor AR ligand binding domain 9606
450 2PIV 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
451 5V39 1 A Vitamin D3 receptor 9606
452 5TMT 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
453 4MG7 1 A Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
454 4MG7 2 B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
455 4POJ 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
456 1Y9R 1 A, B Mineralocorticoid receptor LIGAND-BINDING DOMAIN 9606
457 4OK1 1 A Androgen receptor ligand binding doamin 9606
458 3VHU 1 A Mineralocorticoid receptor LIGAND-BINDING DOMAIN, UNP residues 712-984 9606
459 5APJ 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
460 5DUE 1 A, B Estrogen receptor ligand-binding domain 9606
461 4IW8 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
462 4MGC 1 A, B Estrogen receptor ligand binding domain (UNP residues 302-552) 9606
463 3VSO 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
464 3L1B 1 A Farnesoid X receptor Ligand-binding domain, residues 248-476 9606
465 5KRO 1 A, B Estrogen receptor ligand-binding domain 9606
466 5APK 1 A, B NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, UNP RESIDUES 265-507 9606
467 5TLX 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
468 5NI8 1 A Nuclear receptor ROR-gamma 9606
469 3VRU 1 A Vitamin D3 receptor Ligand binding domain, residues 116-423 10116
470 2GTK 1 A Peroxisome proliferator-activated receptor gamma 9606
471 3KMG 1 A, D Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
472 4OKX 1 A Androgen receptor ligand binding doamin 9606
473 3B0Q 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 231-504 9606
474 6A5Y 1 A Bile acid receptor ligand binding domain 9606
475 6A5Y 3 D Retinoic acid receptor RXR-alpha 9606
476 3HQ5 1 A, B Progesterone receptor residues 678-933 9606
477 5X8S 1 A, B Uncharacterized protein UNP residues 248-505 61853
478 1YIN 1 A Estrogen receptor LIGAND BINDING DOMAIN, residues 307-554 9606
479 2LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD (LIGAND-BINDING DOMAIN), RESIDUES 178 - 423 9606
480 2ZVT 1 A, B Peroxisome proliferator-activated receptor gamma Ligand-binding domain 9606
481 2ZLC 1 A Vitamin D3 receptor VDR-LBD, UNP residues 116-423 10116
482 1X7R 1 A Estrogen receptor 1 (alpha) 9606
483 1XQC 1 A, B, C, D Estrogen receptor ligand binding domain 9606
484 5Q11 1 A Bile acid receptor 9606
485 5TLY 1 A, B Estrogen receptor ligand-binding domain, UNP RESIDUES 125-381 9606
486 4WPF 1 A, D Nuclear receptor ROR-gamma UNP residues 262-509 9606
487 2FAI 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
488 5HZC 1 A, B Peroxisome proliferator-activated receptor gamma 9606
489 5G5W 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, UNP RESIDUES 500-777 9606
490 5Q0T 1 A Bile acid receptor 9606
491 3SP6 1 A Peroxisome proliferator-activated receptor alpha 9606
492 4N5G 1 A, B, C, D Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
493 4OFU 1 A Androgen receptor ligand binding domain 9606
494 5Q1H 1 A, C, E, G Bile acid receptor 9606
495 3F7D 1 A nuclear receptor SF-1 UNP residues 219-462 10090
496 5G45 1 A NUCLEAR RECEPTOR ROR-GAMMA LIGAND BINDING DOMAIN, RESIDUES 265-507 9606
497 5KRM 1 A, B Estrogen receptor ligand-binding domain 9606
498 3NOA 1 A, B Peroxisome proliferator-activated receptor gamma lignad binding domain 9606
499 5LSG 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 223-505 9606
500 4WHG 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
501 2QGT 1 A, B Estrogen receptor Steroid-binding region, residues 298-554 9606
502 5EC9 1 A Retinoic acid receptor RXR-alpha 9606
503 5TMO 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
504 6C42 1 A, B Estrogen receptor 9606
505 3V9Y 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 234-505 9606
506 3VJT 1 A Vitamin D3 receptor ligand-binding domain, UNP residues 116-423 10116
507 4EM9 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, UNP RESIDUES 235-505 9606
508 4QM0 1 A, C Nuclear receptor ROR-gamma unp residues 262-507 9606
509 1YYE 1 A, B Estrogen receptor beta Ligand Binding Domain 9606
510 5Q0Y 1 A, C Bile acid receptor 9606
511 2Q59 1 A Peroxisome Proliferator-Activated Receptor gamma CYS A 285 IS 2-HYDROXYETHYLATED Ligand binding domain 9606
512 2Q59 2 B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
513 5DKG 1 A, B Estrogen receptor ligand-binding domain 9606
514 1G5Y 1 A, B, C, D RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN (RESIDUES 225 - 462) 9606
515 2HWQ 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
516 5DI7 1 A, B Estrogen receptor ligand-binding domain 9606
517 1T76 1 A Androgen receptor ligand binding domain 9598
518 4X1G 1 A Nuclear receptor subfamily 1 group I member 2 UNP residues 130-434 9606
519 5Q0M 1 A Bile acid receptor 9606
520 5U3U 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
521 2ZXN 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-423 10116
522 6AD9 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
523 3ADX 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
524 5DX3 1 A Estrogen receptor 9606
525 5DX3 2 B Estrogen receptor 9606
526 3OLS 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
527 2NV7 1 A, B Estrogen receptor beta 9606
528 2Q61 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
529 6EL7 1 A Glucocorticoid receptor Expression and crystallisation mutants: N517D, V571M, F602S, C638D, E684A, W712S 9606
530 3TY0 1 A, B Peroxisome proliferator-activated receptor gamma 9606
531 5UFR 1 A, B Nuclear receptor ROR-gamma UNP residues 265-507 9606
532 3T03 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 234-505 9606
533 5GTO 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 1-283 9606
534 5Q10 1 A Bile acid receptor 9606
535 5DZ1 1 A, B Estrogen receptor ligand-binding domain 9606
536 5Q0X 1 A Bile acid receptor 9606
537 4OEA 1 A Androgen receptor ligand binding domain 9606
538 5U44 1 A, B Peroxisome proliferator-activated receptor delta Ligand-binding domain 9606
539 5DXK 1 A, B Estrogen receptor ligand-binding domain 9606
540 1XAP 1 A Retinoic acid receptor beta ligand binding domain 9606
541 5TML 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
542 4PP3 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
543 5GID 1 A Vitamin D3 receptor UNP RESIDUES 124-164,UNP RESIDUES 212-419 10116
544 5TLF 1 A, B Estrogen receptor ligand-binding domain 9606
545 3K22 1 A, B Glucocorticoid receptor 9606
546 2AWH 1 A, B Peroxisome proliferator activated receptor delta residues 210-477 9606
547 3D24 1 A, C Steroid hormone receptor ERR1 Ligand binding domain: Residues 278-519 9606
548 5JJM 1 A, C, D Androgen receptor 9606
549 5JJM 3 B Androgen receptor 9606
550 2VSR 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 9-(S)-HODE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
551 4XUH 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 232-505 9606
552 4R06 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 233-505 9606
553 6EL9 1 A Glucocorticoid receptor Expression and crystallisation mutants: N517D, V571M, F602S, C638D, E684A, W712S 9606
554 3GWS 1 X Thyroid hormone receptor beta Ligand Binding Domain (UNP residues 202 to 460) 9606
555 5DRM 1 A, B Estrogen receptor 9606
556 5X8Q 1 A, C, E, G Nuclear receptor ROR-gamma UNP residues 261-518 9606
557 6CN5 1 A, B Nuclear receptor ROR-gamma ligand binding domain 9606
558 5E15 1 A, B Estrogen receptor ligand-binding domain 9606
559 2P7G 1 A Estrogen-related receptor gamma 9606
560 1UPV 1 A OXYSTEROLS RECEPTOR LXR-BETA LIGAND BINDING DOMAIN, RESIDUES 209-461 9606
561 5DZ3 1 A, B Estrogen receptor ligand-binding domain 9606
562 2F4B 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
563 4R6S 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 231-505 9606
564 3UUC 1 A, B, C, D Estrogen receptor Ligand binding domain (residues 302-552) 9606
565 5TMZ 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
566 4K4J 1 A Retinoic acid receptor RXR-alpha ligand binding domain, UNP residues 228-458 9606
567 1PQ9 1 A, B, C, D Oxysterols receptor LXR-beta Ligand binding domain, residues 213-461 9606
568 5TM3 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
569 3FS1 1 A Hepatocyte nuclear factor 4-alpha HNF4a Ligand Binding Domain 9606
570 3WMH 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain, UNP residues 223-504 9606
571 5DXP 1 A, B Estrogen receptor ligand-binding domain 9606
572 1N46 1 A, B Thyroid hormone receptor Beta-1 9606
573 2B23 1 A, B Estrogen receptor LIGAND BINDING DOMAIN 9606
574 1N4H 1 A Nuclear Receptor ROR-beta Ligand-Binding Domain 10116
575 3OMM 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
576 4RAK 1 A, B Oxysterols receptor LXR-beta UNP residues 213-460 9606
577 3AUR 1 A Vitamin D3 receptor ligand binding domain 9606
578 3ET2 1 A, B Peroxisome proliferator-activated receptor delta LIGAND BINDING DOMAIN 9606
579 5DIG 1 A, B Estrogen receptor ligand-binding domain 9606
580 5DID 1 A, B Estrogen receptor 9606
581 5OWD 1 A Vitamin D3 receptor A 7955
582 1I37 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN 10116
583 1ZDT 1 A, B Steroidogenic factor 1 9606
584 4IWC 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
585 5U3X 1 A, B Peroxisome proliferator-activated receptor delta UNP RESIDUES 131-402 9606
586 4KZJ 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
587 1S0X 1 A Nuclear receptor ROR-alpha ligand binding domain 9606
588 1ZKY 1 A, B Estrogen receptor Ligand Binding Domain 9606
589 5DYB 1 A, B Estrogen receptor ligand-binding domain 9606
590 2P1V 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
591 5DLR 1 A, B Estrogen receptor ligand-binding domain 9606
592 5YCN 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
593 5Q17 1 A Bile acid receptor 9606
594 2PIR 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
595 3B0R 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 231-504 9606
596 5XPM 1 A Vitamin D3 receptor UNP residues 116-423 10116
597 5TM5 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
598 3E7C 1 A, B Glucocorticoid receptor UNP RESIDUES 521-777 9606
599 5UFS 1 A, B Ancestral Glucocorticoid Receptor2 Ligand Binding Domain 32644
600 1T73 1 A Androgen receptor ligand binding domain 9598
601 5TLU 1 A, B Estrogen receptor ligand-binding domain 9606
602 2ZMH 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
603 5VB5 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
604 3VTB 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
605 3HVL 1 A, B Pregnane X receptor, Linker, Steroid receptor coactivator 1 PXR, residues 130-434, linker, SRC-1, residues 678-700 9606 2.3.1.48 | Details
606 2P1U 1 A Retinoic acid receptor RXR-alpha ligand binding domain (residues 223-462) 9606
607 4YPQ 1 A Nuclear receptor ROR-gamma UNP residues 265-507 9606
608 1M13 1 A Orphan Nuclear Receptor PXR Includes Ligand Binding Domain (Residues 130-434) 9606
609 3ADW 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
610 2Q70 1 A, B Estrogen receptor ligand-binding domain (Residues 304-551) 9606
611 5DU5 1 A, B Estrogen receptor 9606
612 5TM4 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
613 3G8I 1 A Peroxisome proliferator-activated receptor alpha Ligand bind domain 9606
614 3OKI 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
615 4RE8 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
616 3FXV 1 A NR1H4 protein ligand binding domain, residues 248-475 9606
617 5DUH 1 A, B Estrogen receptor ligand-binding domain 9606
618 5DUG 1 A, B Estrogen receptor ligand-binding domain 9606
619 5DZ0 1 A, B Estrogen receptor ligand-binding domain 9606
620 5TN7 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
621 3VT5 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
622 5NKY 1 A Vitamin D3 receptor A 7955
623 4OFR 1 A Androgen receptor ligand binding domain 9606
624 5E19 1 A, B Estrogen receptor ligand-binding domain 9606
625 3KWY 1 A Retinoic acid receptor RXR-alpha ligand binding domain 9606
626 5C4U 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
627 3UU7 1 A Estrogen receptor Ligand binding domain (residues 302-552) 9606
628 3UU7 2 B Estrogen receptor Ligand binding domain (residues 302-552) 9606
629 5DWL 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
630 1PZL 1 A Hepatocyte nuclear factor 4-alpha HNF4A-LDB 9606
631 2PIO 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
632 5LYQ 1 A Retinoic acid receptor RXR-alpha UNP residues 223-462 9606
633 5TM1 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
634 5NFT 1 A Glucocorticoid receptor 9606
635 5TMQ 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
636 2EWP 1 A, B, C, D, E Estrogen-related receptor gamma 9606
637 5TMM 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
638 5TMS 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
639 4Q13 1 A, B Estrogen receptor D538G 9606
640 5TLV 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
641 3LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD, LIGAND-BINDING DOMAIN, RESIDUES 178 - 423 9606
642 3D57 1 A, B Thyroid hormone receptor beta C-terminal domain 9606
643 5DXR 1 A, B Estrogen receptor ligand-binding domain 9606
644 1S9P 1 A, B, C, D Estrogen-related receptor gamma 10090
645 2YHD 1 A ANDROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 671-919 9606
646 5VB7 1 A Nuclear receptor ROR-gamma, SRC2 chimera residues 260-507 9606
647 5TLG 1 A, B Estrogen receptor ligand-binding domain 9606
648 3PBA 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
649 5TMW 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
650 4R2U 1 A, D Peroxisome proliferator-activated receptor gamma UNP residues 231-505 9606
651 3VJH 1 A, B Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-504 9606
652 5AK2 1 A, B ESTROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 307-554 9606
653 3WTQ 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-423 10116
654 5ZWF 1 A Vitamin D3 receptor 10116
655 4ZNW 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
656 3OMO 1 A, B Estrogen receptor beta Ligand Binding Domain (UNP residues 261-500) 9606
657 3B0W 1 A, B Nuclear receptor ROR-gamma LIGAND-BINDING DOMAIN, UNP residues 265-507 9606
658 5E14 1 A, B Estrogen receptor ligand-binding domain 9606
659 4LSJ 1 A Glucocorticoid receptor Steroid-binding region, residues 522-777 9606
660 3FUR 1 A Peroxisome proliferator-activated receptor gamma LBD (ligand binding domain), UNP residues 234-505 9606
661 1QKN 1 A ESTROGEN RECEPTOR BETA COMPLEXED WITH THE ANTAGONIST RALOXIFENE LIGAND-BINDING DOMAIN 10116
662 4IU7 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
663 4UDB 1 A MINERALOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 735-984 9606
664 3R5N 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain (UNP residues 232-505) 9606
665 5YP6 1 A Nuclear receptor ROR-gamma 9606
666 3WT7 1 A Vitamin D3 receptor Ligand binding domain, UNP residues 116-164, 212-423 10116
667 2H77 1 A THRA protein 9606
668 5KRI 1 A, B Estrogen receptor ligand-binding domain 9606
669 5TTO 1 A, B Peroxisome proliferator-activated receptor gamma residues 233-505 9606
670 5DIE 1 A, B Estrogen receptor ligand-binding domain 9606
671 5TMR 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
672 5AWJ 1 A Vitamin D3 receptor,Vitamin D3 receptor deletion mutant, residues 165-211 UNP RESIDUES 116-164, 212-423 10116
673 4ZOM 1 A, B, C, D Nuclear receptor ROR-gamma ligand binding domain 9606
674 3OOF 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
675 4IV4 1 A, B Estrogen receptor Ligand-binding Domain, UNP residues 303-549 9606
676 5TLO 1 A, B Estrogen receptor ligand-binding domain 9606
677 4KZM 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
678 3V3Q 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand-bingding domain, UNP residues 351-598 9606
679 2YLP 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 664-919 9606
680 6FO8 1 1 Vitamin D3 receptor A HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS 7955
681 1FM9 1 A RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN - RESIDUES 225 - 462 9606
682 1FM9 2 D PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN - RESIDUES 206 - 477 9606
683 6F2L 1 A, B Peroxisome proliferator-activated receptor gamma 9606
684 3OSA 1 A, B, C, D Estrogen receptor 9606
685 3SP9 1 A, B Peroxisome proliferator-activated receptor delta ligand binding domain 9606
686 5KRH 1 A, B Estrogen receptor ligand-binding domain 9606
687 5DVC 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
688 5Q16 1 A, C Bile acid receptor 9606
689 5TN9 1 A, B, C, D Estrogen receptor ligand-binding domain 9606
690 5HYR 1 A, B Estrogen receptor UNP Residues 302-559 9606
691 3G9E 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
692 2HC4 1 A Vitamin D receptor Ligand binding domain 7955
693 2AA5 1 A, B Mineralocorticoid receptor Ligand Binding Domain 9606
694 1S9Q 1 A, B Estrogen-related receptor gamma 10090
695 4L96 1 A Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN (UNP RESIDUES 235-505) 9606
696 3X31 1 A Vitamin D3 receptor ligand binding domain (UNP residues 118-164, 216-427) 9606
697 5U2B 1 A, B, C, D, E, F Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
698 5EI1 1 A, B Estrogen receptor ligand-binding domain 9606
699 4YNK 1 A Vitamin D3 receptor,Vitamin D3 receptor UNP residues 116-164,212-423,UNP residues 116-164,212-423 10116
700 5WGQ 1 A, B Estrogen receptor 9606
701 5DK9 1 A, B Estrogen receptor ligand-binding domain 9606
702 1U3R 1 A, B Estrogen receptor beta 9606
703 2PIU 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
704 3L0E 1 A Oxysterols receptor LXR-beta UNP residues 213-461 9606
705 1QKT 1 A ESTRADIOL RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 304-551 9606
706 3OZJ 1 A, C Retinoic acid receptor RXR-alpha ligand-binding domain, UNP residues 225-462 9606
707 5KRL 1 A, B Estrogen receptor ligand-binding domain 9606
708 4QL8 1 A Androgen receptor Androgen receptor ligand binding domain, UNP residues 662-919 9606
709 2AA7 1 A Mineralocorticoid receptor Ligand Binding Domain 9606
710 4K6I 1 A Retinoic acid receptor RXR-alpha ligand binding domain, UNP residues 228-458 9606
711 5DKB 1 A, B Estrogen receptor ligand-binding domain 9606
712 4DMA 1 A, B Estrogen receptor unp residues 303-549 9606
713 2P7A 1 A Estrogen-related receptor gamma 9606
714 5E7V 1 A Vitamin D3 receptor A 7955
715 4J26 1 A, B Estrogen receptor beta Ligand Binding Domain, UNP residues 261-500 9606
716 1X76 1 A, B Estrogen receptor beta 9606
717 1XQ3 1 A androgen receptor inhibited by r1881 ligand binding domain 9606
718 4ZN9 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
719 4XT9 1 A Nuclear receptor ROR-gamma UNP residues 265-507 9606
720 3W5R 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
721 1ZAF 1 A, B Estrogen receptor beta 9606
722 3BC5 1 A Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
723 5KRC 1 A, B Estrogen receptor ligand-binding domain 9606
724 2PRG 1 A, B PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LBD (LIGAND BINDING DOMAIN), RESIDUES 207-477 9606
725 6ENQ 1 A, B Peroxisome proliferator-activated receptor gamma 9606
726 2GIU 1 A Estrogen receptor beta LIGAND-BINDING DOMAIN (Residues 260-500) 9606
727 5KR9 1 A, B Estrogen receptor ligand-binding domain 9606
728 3VT9 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
729 3OS9 1 A, B, C, D Estrogen receptor 9606
730 2I4J 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), residues 223-504 9606
731 1NHZ 1 A GLUCOCORTICOID RECEPTOR residue 500-777, hinge and steroid binding domains 9606
732 5DWG 1 A, B Estrogen receptor ligand-binding domain 9606
733 2XYJ 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR DELTA LIGAND BINDING DOMAIN, RESIDUES 165-441 9606
734 2Q5P 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
735 5KRF 1 A, B Estrogen receptor ligand-binding domain 9606
736 5Q0N 1 A, C Bile acid receptor 9606
737 4M8H 1 A Retinoic acid receptor RXR-alpha HRXRALPHA-LBD, UNP RESIDUES 228-458 9606
738 2REW 1 A Peroxisome proliferator-activated receptor alpha ligand binding domain, residues 196-468 9606
739 3SZ1 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
740 4BCR 1 A, B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN, RESIDUES 195-468 9606 2.3.1.48 | Details
741 1FM6 1 A, U RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN - RESIDUES 225 -462 9606
742 1FM6 2 D, X PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA LIGAND BINDING DOMAIN - RESIDUES 206 - 477 9606
743 4XUM 1 A, B Peroxisome proliferator-activated receptor gamma 9606
744 5DP0 1 A, B Estrogen receptor 9606
745 5HCV 1 A, B, C Mineralocorticoid receptor ligand-binding domain (UNP residues 732-984) 9606
746 3W5T 1 A Vitamin D3 receptor VDR-LBD, UNP RESIDUES 116-423 10116
747 5TM7 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
748 4L98 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN (UNP RESIDUES 235-505) 9606
749 4QJR 1 A Steroidogenic factor 1 UNP residues 218-461 9606
750 3H0A 1 A Retinoic acid receptor RXR-alpha UNP RESIDUES 228-455 9606
751 3H0A 2 D Peroxisome proliferator-activated receptor gamma UNP RESIDUES 234-505 9606
752 5DTV 1 A, B Estrogen receptor 9606
753 2HVC 1 A Androgen receptor ligind-binding domain(residues 669-918) 9606
754 2J4A 1 A THYROID HORMONE RECEPTOR BETA-1 LIGAND BINDING DOMAIN, RESIDUES 209-461 9606
755 4RME 1 A Retinoic acid receptor RXR-alpha ligand binding domain 228-458 9606
756 3VT6 1 A Vitamin D3 receptor UNP RESIDUES 116-423 10116
757 1PDU 1 A, B nuclear hormone receptor HR38 N-terminal, ligand binding domain 7227
758 5DXM 1 A, B Estrogen receptor ligand-binding domain 9606
759 5OW9 1 A Vitamin D3 receptor A 7955
760 4JYG 1 A, B Retinoic acid receptor beta Ligand binding domain, UNP residues 176-421 9606
761 1OVL 1 A, D Orphan nuclear receptor NURR1 (MSE 414, 496, 511) 9606
762 1OVL 2 B, C, E, F Orphan nuclear receptor NURR1 (MSE 496, 511) 9606
763 6C1I 1 A, B Peroxisome proliferator-activated receptor gamma 9606
764 3KYT 1 A Nuclear receptor ROR-gamma lipid binding domain 9606
765 5XPO 1 A Vitamin D3 receptor UNP residues 116-423 10116
766 5TLD 1 A, B Estrogen receptor ligand-binding domain 9606
767 4HLW 1 A Androgen receptor UNP residues 664-919 9606
768 2G5O 1 A, B Estrogen receptor Ligand Binding Domain 9606
769 2ATH 1 A, B Peroxisome proliferator activated receptor gamma ligand binding domain 9606
770 4RUJ 1 A Vitamin D3 receptor A ligand binding domain, UNP residues 156-453 7955
771 5C4S 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
772 2ABI 1 A, B, C Mineralocorticoid receptor LIGAND-BINDING DOMAIN 9606
773 5X8W 1 A Uncharacterized protein UNP residues 248-505 61853
774 3PO9 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain 9606
775 4WHF 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
776 5TMV 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
777 5DVS 1 A, B Estrogen receptor ligand-binding domain 9606
778 2Q3Y 1 A Ancestral Corticiod Receptor Ligand Binding Domain 32644
779 4REE 1 A, B Nuclear receptor subfamily 4 group A member 1 UNP residues 351-598 9606
780 1I38 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN 10116
781 5TMU 1 A, B Estrogen receptor ligand-binding domain (UNP residues 298-554) 9606
782 5Q1B 1 A, C Bile acid receptor 9606
783 3VHW 1 A Vitamin D3 receptor ligand binding domain, residues 118-427 9606
784 3L0J 1 A Nuclear receptor ROR-gamma Retinoic acid-related orphan receptor gamma 9606
785 5C4O 1 A Nuclear receptor ROR-gamma Ligand-binding residues 267-507 9606
786 2PIN 1 A, B Thyroid hormone receptor beta-1 Ligand-binding domain (residues 209-461) 9606
787 5G3J 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 500-777 9606
788 5DXQ 1 A, B Estrogen receptor ligand-binding domain 9606
789 4POH 1 A Retinoic acid receptor RXR-alpha Ligand Binding Domain, UNP residues 228-458 9606
790 4K7A 1 A Androgen receptor ligand binding domain, UNP residues 670-918 9606
791 5DWI 1 A, B Estrogen receptor ligand-binding domain 9606
792 1I7G 1 A PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN 9606
793 5TLL 1 A, B Estrogen receptor ligand-binding domain 9606
794 4CI4 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR ALPHA LIGAND BINDING DOMAIN, RESDIUES 195-468 9606 2.3.1.48 | Details
795 4ZNU 1 A, B Estrogen receptor ligand-binding domain, UNP residues 301-559 9606
796 4LBD 1 A RETINOIC ACID RECEPTOR GAMMA LBD, LIGAND-BINDING DOMAIN, RESIDUES 178 - 423 9606
797 4XHD 1 A Nuclear receptor subfamily 1 group I member 2 9606
798 4YT1 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 223-504 9606
799 3ADV 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
800 6CN6 1 A Nuclear receptor ROR-gamma ligand binding domain 9606
801 3ADS 1 A, B Peroxisome proliferator-activated receptor gamma ligand-binding domain, residues in UNP 223-505 9606
802 1FBY 1 A, B RETINOIC ACID RECEPTOR RXR-ALPHA LIGAND BINDING DOMAIN 9606
803 3PEQ 1 A, B Peroxisome proliferator-activated receptor delta unp residues 171-441 9606
804 1X78 1 A, B Estrogen receptor beta 9606
805 1X7B 1 A, B Estrogen receptor beta 9606
806 5NTI 1 A, B, C, D Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
807 2VV1 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 4-HDHA LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
808 2VV1 2 B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 4-HDHA LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
809 4CSJ 1 A GLUCOCORTICOID RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 500-777 9606
810 1HJ1 1 A OESTROGEN RECEPTOR BETA COMPLEXED WITH THE FULL ANTAGONIST ICI164,384 LIGAND-BINDING DOMAIN 10116
811 2NPA 1 A, C Peroxisome proliferator-activated receptor alpha ligand binding domain 9606
812 4XLD 1 A Peroxisome proliferator-activated receptor gamma UNP residues 203-477 9606
813 3HOD 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), UNP residues 223-504 9606
814 4FHH 1 A Vitamin D3 receptor A UNP RESIDUES 156-453 7955
815 5LWP 1 A Nuclear receptor ROR-gamma 9606
816 3ET0 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN 9606
817 5Q1F 1 A, C Bile acid receptor 9606
818 2PJL 1 A, B Steroid hormone receptor ERR1 ligand binding domain 9606
819 6BN6 1 A, B Nuclear receptor ROR-gamma Ligand-binding domain 9606
820 5GTP 1 A Peroxisome proliferator-activated receptor gamma UNP RESIDUES 223-505 9606
821 5A86 1 A, B NUCLEAR RECEPTOR SUBFAMILY 1 GROUP I MEMBER 2 9606
822 2P4Y 1 A, B Peroxisome proliferator-activated receptor gamma Ligand-binding Domain (LBD), Residues 231-505 9606
823 4OJ4 1 A Peroxisome proliferator-activated receptor gamma Ligand binding domain (UNP residues 232-505) 9606
824 5KRK 1 A, B Estrogen receptor ligand-binding domain 9606
825 2YLQ 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 664-919 9606
826 5F9B 1 A, B Peroxisome proliferator-activated receptor gamma UNP residues 195-477 9606
827 5IXK 1 A, B Nuclear receptor ROR-gamma Ligand Binding Domain UNP Residue 268-487 9606
828 3D90 1 A, B Progesterone receptor Ligand-binding domain, UNP residues 676-933 9606
829 4OKT 1 A Androgen receptor ligand binding doamin 9606
830 4EMA 1 A, B Peroxisome proliferator-activated receptor gamma LIGAND BINDING DOMAIN, UNP RESIDUES 235-505 9606
831 4DM8 1 A, B Retinoic acid receptor beta unp residues 176-421 9606
832 5ZWI 1 A Vitamin D3 receptor 10116
833 6FOD 1 A Vitamin D3 receptor A 7955
834 5KRA 1 A, B, E, F Estrogen receptor ligand-binding domain 9606
835 5NI5 1 A Nuclear receptor ROR-gamma The protein construct include a N-terminal HN-tag and a C-terminal SRC2-2 peptide 9606
836 4N1Y 1 A, B, C, D Estrogen receptor unp residues 245-481 29159
837 3DT3 1 A, B Estrogen receptor ligand binding domain 9606
838 5GIE 1 A, D Vitamin D3 receptor UNP RESIDUES 117-164,UNP RESIDUES 212-419 10116
839 2Q8S 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain (residue 235-505) 9606
840 1XZX 1 X Thyroid hormone receptor beta-1 ligand binding domain (residues 202-461) 9606
841 6DUP 1 A, B Nuclear receptor subfamily 1 group I member 2 9606
842 1PK5 1 A, B Orphan nuclear receptor NR5A2 LRH-1 LBD 10090
843 2POB 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
844 1PRG 1 A, B PROTEIN (PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA) LBD (LIGAND BINDING DOMAIN), RESIDUES 207-476 9606
845 5T92 1 A, B Estrogen receptor residues 301-553 9606
846 4M8E 1 A Retinoic acid receptor RXR-alpha HRXRALPHA-LBD, UNP RESIDUES 228-458 9606
847 3HZF 1 A Thyroid hormone receptor, alpha isoform 1 variant residues 135-397 9606
848 3CS8 1 A Peroxisome proliferator-activated receptor gamma LBD domain (UNP residues 234-504) 9606
849 6FGQ 1 A, B Nuclear receptor ROR-gamma 9606
850 6B33 1 A, B Nuclear receptor ROR-gamma 9606
851 3AN3 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
852 1PQ6 1 A, B, C, D Oxysterols receptor LXR-beta Ligand binding domain, residues 213-461 9606
853 4ZJW 1 A, B Nuclear receptor ROR-gamma ligand binding domain (UNP Residues 265-487) 9606
854 3P89 1 A Farnesoid X receptor unp residues 244-472 9606
855 5ZA1 1 A, B Nuclear receptor ROR-gamma UNP residues 265-494 9606
856 1T5Z 1 A Androgen receptor AR Ligand Binding Domain 669-918 9606
857 2PIQ 1 A Androgen receptor Ligand-binding domain (residues 669-919) 9606
858 1E3G 1 A ANDROGEN RECEPTOR LIGAND-BINDING DOMAIN RESIDUES 447-709 9606
859 4KZI 1 A, B Nuclear receptor subfamily 4 group A member 1 ligand binding domain, UNP residues 351-598 9606
860 2I4Z 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD), residues 223-504 9606
861 3VN2 1 A Peroxisome proliferator-activated receptor gamma Ligand biding domain, UNP residues 225-505 9606
862 3OOK 1 A, C Bile acid receptor UNP RESIDUES 258-486 9606
863 4RFW 1 A Retinoic acid receptor RXR-alpha ligand binding domain residues 228-458 9606
864 5EJV 1 A, B Nuclear receptor ROR-gamma Ligand Binding Domain (UNP residues 259-518) 9606
865 1XNN 1 A Androgen receptor LIGAND-BINDING DOMAIN 10116
866 4HEE 1 X Peroxisome proliferator-activated receptor gamma peroxisome proliferator-activated receptor-gamma (UNP Residues 235-505) 9606
867 5Q0Z 1 A, C Bile acid receptor 9606
868 3X1H 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 232-505 9606
869 5GIC 1 A Vitamin D3 receptor UNP RESIDUES 124-164,UNP RESIDUES 212-420 10116
870 5WQX 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain, UNP residues 232-505 9606
871 5Q1C 1 A, C Bile acid receptor 9606
872 3O1D 1 A Vitamin D3 receptor A Ligand Binding Domain (UNP Residues 156-453) 7955
873 2Q6S 1 A, B Peroxisome Proliferator-Activated Receptor gamma Ligand binding domain 9606
874 1XVP 1 A, C Retinoic acid receptor RXR-alpha LBD domain 9606
875 1XVP 2 B, D Orphan nuclear receptor NR1I3 LBD domain 9606
876 3ZQT 1 A ANDROGEN RECEPTOR LIGAND BINDING DOMAIN, RESIDUES 664-919 562
877 1XIU 1 A, B RXR-like protein Ligand-binding domain (LBD) 6526
878 4OAR 1 A Progesterone receptor Steroid-binding Region 9606
879 2JJ3 1 A, B ESTROGEN RECEPTOR BETA LIGAND-BINDING DOMAIN, RESIDUES 256-505 9606
880 1UOM 1 A ESTROGEN RECEPTOR NVP-ADD562 L SOLVENT S LIGAND BINDING DOMAIN, RESIDUES 301 - 553 9606
881 2ZMJ 1 A Vitamin D3 receptor LIGAND BINDING DOMAIN, UNP residues 116-423 10116
882 5NTQ 1 A, B Nuclear receptor ROR-gamma C-terminal domain, ligand binding domain 9606
883 2I4P 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domain (LBD) 9606
884 3AN4 1 A, B Peroxisome proliferator-activated receptor gamma Ligand binding domain 9606
885 4FHI 1 A Vitamin Nuclear Receptor 7955
886 6FO7 1 A Vitamin D3 receptor A 7955
887 5MKJ 1 A Retinoic acid receptor RXR-alpha 9606
888 1GWQ 1 A, B OESTROGEN RECEPTOR LIGAND-BINDING DOMAIN (DOMAIN E - RESIDUES 260-500) IN COMPLEX WITH THE AGONIST RALOXIFENE CORE LIGAND-BINDING DOMAIN, RESIDUES 301-548 9606
889 5Q0S 1 A, C Bile acid receptor 9606
890 3ET1 1 A, B Peroxisome proliferator-activated receptor alpha LIGAND BINDING DOMAIN 9606
891 2IOK 1 A, B Estrogen receptor Steroid-binding region, residues 306-554 9606
892 3FAL 1 A, C Retinoic acid receptor RXR-alpha residues 225-462 9606
893 3FAL 2 B, D Oxysterols receptor LXR-alpha residues 200-445 10090
894 4OIL 1 A Androgen receptor ligand binding doamin 9606
895 5U5L 1 A, B Peroxisome proliferator-activated receptor gamma residues 233-505 9606
896 3GN8 1 A, B Glucocorticoid receptor 2 9606
897 3GBK 1 A, B Peroxisome proliferator-activated receptor gamma ligand binding domian, UNP residues 235-505 9606
898 3QT0 1 A Peroxisome proliferator-activated receptor gamma UNP residues 235-505 9606
899 5NMB 1 A2 Vitamin D3 receptor A UNP residues 156-453 7955
900 2YAT 1 A ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN, RESIDUES 301-551 9606
901 4OC7 1 A Retinoic acid receptor RXR-alpha ligand binding domain (UNP residues 223-462) 9606
902 5TM9 1 A, B Estrogen receptor ligand-binding domain, UNP residues 125-381 9606
903 3JZC 1 A Thyroid hormone receptor beta UNP residues 202-461, Ligand Binding Domain 9606
904 2VV4 1 A PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 6-OXOOTE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
905 2VV4 2 B PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA 6-OXOOTE LIGAND BINDING DOMAIN, RESIDUES 202-475 9606
906 5TM6 1 A, B Estrogen receptor ligand-binding domain 9606
907 2GP7 1 A, B, C, D Estrogen-related receptor gamma Residues 229-458 9606
908 4ITE 1 A Vitamin D3 receptor ligand binding domain, residues 118-427