Sequence Similarity Clusters for the Entities in PDB 1DQD

Entity #1 | Chains: L
FAB HGR-2 F6 protein, length: 221 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 61956
95 % 2 10 3687 Flexibility: Low
Max RMSD: 2.9, Avg RMSD: 1.3
PDBFlex
90 % 27 148 144
70 % 809 2479 1
50 % 1657 5021 1
40 % 1657 5021 1
30 % 1891 5951 1
Entity #2 | Chains: H
FAB HGR-2 F6 protein, length: 222 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 61876
95 % 1 1 43447
90 % 6 14 2689
70 % 801 2429 2
50 % 1658 5021 1
40 % 1658 5021 1
30 % 1892 5951 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 4NZU 2 H 13PL light chain Fab 9606
3 1MJU 1 L IMMUNOGLOBULIN MS6-12 Fab fragment, LIGHT CHAIN 10090
4 1MJU 2 H IMMUNOGLOBULIN MS6-12 Fab fragment, HEAVY CHAIN 10090
5 4TRP 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
6 4TRP 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
7 1MEX 1 L Fab 29G12 light chain 10090
8 1MEX 2 H Fab 29G12 heavy chain 10090
9 3D9A 2 L Light Chain of HyHel10 Antibody Fragment (Fab) 10090
10 3D9A 3 H Heavy Chain of HyHel10 Antibody Fragment (Fab) 10090
11 6EH4 1 D Human T Cell Receptor Alpha Chain 9606
12 6EH4 2 E Human T Cell Receptor Beta Chain 9606
13 4BUH 1 A, B CLONE M0418 SCFV 9606
14 3TV3 1 L PGT128 light chain, Ig lambda-2 chain C regions PGT128 light chain 9606
15 3TV3 2 H PGT128 heavy chain, Ig gamma-1 chain C region PGT128 heavy chain 9606
16 6FR4 1 A TCR 003 alpha chain 9606
17 6FR4 2 B TCR 003 Beta Chain 9606
18 1NCW 1 L IMMUNOGLOBULIN IGG2A Antibody FAB fragment 4C6, light chain 10090
19 1NCW 2 H IMMUNOGLOBULIN IGG2A Antibody FAB fragment 4C6, heavy chain 10090
20 6EH5 1 A Human T Cell Receptor Alpha Chain 9606
21 6EH5 2 B Human T Cell Receptor Beta Chain 9606
22 5UD9 1 H Fab heavy chain 9606
23 5UD9 2 L Light chain 9606
24 4P48 1 A Antibody scFv 180 9031
25 4UDT 1 A T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C REGION VARIABLE DOMAIN TRAV22, RESIDUES 1-112, CONSTANT DOMAIN TRAC1, RESIDUES 2-95 9606
26 4UDT 2 B PROTEIN TRBV7-9, T-CELL RECEPTOR BETA-2 CHAIN C REGION VARIABLE DOMAIN TRBV7-9, RESIDUES 20-115, CONSTANT DOMAIN TRBC2, RESIDUES 1-129 9606
27 5TY6 1 H VRC 315 13-1b02 Fab Heavy chain 9606
28 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
29 6FR3 1 A 003 TCR Alpha Chain 9606
30 6FR3 2 B 003 TCR Beta Chain 9606
31 2XZC 1 H FAB A.17 HEAVY CHAIN 9606
32 2XZC 2 L FAB A.17 LIGHT CHAIN 9606
33 2XKN 1 A, C ANTI-EGFR ANTIBODY 7A7 FAB FRAGMENT LIGHT CHAIN (IGG1), RESIDUES 1-223 10090
34 2XKN 2 B, D ANTI-EGFR ANTIBODY 7A7 FAB FRAGMENT HEAVY CHAIN (IGG1), RESIDUES 1-216 10090
35 5KVG 2 L ZV-67 Antibody Fab Light Chain 10090
36 5KVG 3 H ZV-67 Antibody Fab Heavy Chain 10090
37 5WCA 1 H VRC315 27-1C08 Fab Heavy chain 9606
38 5WCA 2 L VRC315 27-1C08 Fab Light chain 9606
39 6FR5 1 A TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain 9606
40 6FR5 2 B TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, beta chain 9606
41 4XCF 1 L 4E10 Fab light chain 9606
42 4XCF 2 H 4E10 Fab heavy chain 9606
43 5KVF 2 L ZV-64 Antibody Fab Light Chain 10090
44 5KVF 3 H ZV-64 Antibody Fab Heavy Chain 10090
45 1RUP 1 L immunoglobulin igg2a, heavy chain fab 10090
46 1RUP 2 H immunoglobulin igg2a, light chain fab 10090
47 3ESU 1 F Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker 10090
48 1RUK 1 L immunoglobulin igg2a, light chain fab 10090
49 1RUK 2 H immunoglobulin igg2a, heavy chain fab 10090
50 5VXR 1 H MAb24 Variable Heavy Chain,MAb24 Variable Heavy Chain 10090
51 5VXR 2 L MAb24 Variable Light Chain,MAb24 Variable Light Chain 10090
52 5X08 1 H Fab 4E10 Heavy chain 9606
53 5X08 2 L Fab 4E10 Light chain 9606
54 4WW1 1 A TCR Alpha Chain-TRAV21-TRAJ8 9606
55 4WW1 2 B TCR Beta Chain-TRBV7-8 9606
56 4XAW 1 L 4E10 Fab light chain 9606
57 4XAW 2 H 4E10 Fab heavy chain 9606
58 4P49 1 A Antibody scFv B8 9031
59 3N9G 1 H Fab fragment of MAb CR4354, heavy chain 9606
60 3N9G 2 L Fab fragment of MAb CR4354, light chain 9606
61 4TUL 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
62 4TUL 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
63 2NW2 1 A ELS4 TCR alpha chain 9606
64 2NW2 2 B ELS4 TCR beta chain 9606
65 5UCB 1 H Fab Heavy Chain 9606
66 5UCB 2 L Fab Light Chain 9606
67 2VXV 1 H HUMAN IGG ABT-325 9606
68 2VXV 2 L HUMAN IGG ABT-325 9606
69 4GXV 1 H, I Antibody 1F1, heavy chain 9606
70 4GXV 2 L, M Antibody 1F1, light chain 9606
71 6AT6 1 B T-cell receptor beta variable 28, Human nkt tcr beta chain chimera 9606
72 6AT6 2 A T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera 9606
73 2VXT 1 H MURINE IGG 125-2H 10090
74 2VXT 3 L MURINE IGG 125-2H 10090
75 1RUM 1 L immunoglobulin igg2a, light chain fab 10090
76 1RUM 2 H immunoglobulin igg2a, heavy chain fab 10090
77 2XZA 1 H FAB A.17 HEAVY CHAIN 9606
78 2XZA 2 L FAB A.17 LIGHT CHAIN 9606
79 1OGA 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
80 1OGA 5 E T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR, RESIDUES 1-130 9606
81 2W60 1 A ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 10090
82 2W60 2 B ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 10090
83 5W24 1 L 5C4 Fab Light Chain 10090
84 5W24 2 H 5C4 Fab Heavy Chain 10090
85 4HPY 1 H CH59 Fab heavy chain 9606
86 4HPY 2 L CH59 Fab light chain 9606
87 3T65 1 B S25-2 FAB (IGG1K) heavy chain 10090
88 3T65 2 A S25-2 FAB (IGG1K) light chain 10090
89 5C6W 1 H, J Protein IGHV1-69-2,Ig lambda chain V-II region NIG-84 9606
90 4JG1 1 L Fab light chain 9606
91 4JG1 2 H Fab heavy chain 9606
92 3M8O 1 L IMMUNOGLOBULIN A1 LIGHT CHAIN Fab fragment 9606
93 3M8O 2 H IMMUNOGLOBULIN A1 HEAVY CHAIN Fab fragment 9606
94 5VF2 1 A scFv 2D10 10090
95 5I8C 1 A VRC34.01 Fab heavy chain 9606
96 5I8C 2 B VRC34.01 Fab light chain 9606
97 4O5L 1 L Fab F045-092 light chain 9606
98 4O5L 2 H Fab F045-092 heavy chain 9606
99 5MYX 1 A, C Fab c#24 light chain 10090
100 5MYX 2 B, D Fab c#24 heavy chain Pyroglutamate residue 1 (PCA) results from post-translational modification of original residue glutamine 1. 10090
101 3IFL 1 L 12A11 FAB antibody light chain 10090
102 3IFL 2 H 12A11 FAB antibody heavy chain 10090
103 5WK2 1 L M116 LIGHT CHAIN 9606
104 5WK2 2 H M116 HEAVY CHAIN FD 9606
105 3PP4 1 H GA101 Fab heavy chain 10090
106 3PP4 2 L GA101 Fab light chain 10090
107 3KDM 1 A, L Immunoglobulin light chain 9606
108 3KDM 2 B, H Immunoglobulin heavy chain 9606
109 5NIV 1 A Light chain of 5D3 Fab 10090
110 5NIV 2 B Heavy chain of 5D3 Fab 10090
111 5N4J 1 L LIGHT CHAIN 9606
112 5N4J 2 H HEAVY CHAIN the sequence provided include the cleavable tag 9606
113 2AJU 1 L ANTIBODY 7A1 FAB' IMMUNOGLOBULIN IGG1 KAPPA LIGHT CHAIN 10090
114 2AJU 2 H ANTIBODY 7A1 FAB' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
115 2AJV 1 L Antibody 7A1 Fab' IMMUNOGLOBULIN IGG1 KAPPA LIGHT CHAIN 10090
116 2AJV 2 H Antibody 7A1 Fab' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
117 5X4G 1 A 6H8 Fab heavy chain 10090
118 5X4G 2 B 6H8 Fab light chain 10090
119 3SY0 1 A S25-2 FAB (IGG1K) light chain 10090
120 3SY0 2 B S25-2 FAB (IGG1K) heavy chain 10090
121 4PTU 1 A Antibody pn132p2C05, light chain 9606
122 4PTU 2 B Antibody pn132p2C05, heavy chain 9606
123 4TPR 1 L If kappa light chain 10090
124 4TPR 2 H Fab heavy chain 10090
125 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
126 4HS6 3 B, H MRCT10.v362 Fab heavy chain 9606
127 3IFN 1 H 12A11 FAB antibody heavy chain 10090
128 3IFN 2 L 12A11 FAB antibody light chain 10090
129 5U3P 1 H DH511.4 Fab Heavy Chain 9606
130 5U3P 2 L DH511.4 Fab Light Chain 9606
131 6BLA 1 H AMM01 Fab Heavy chain 9606
132 6BLA 2 L AMM01 Fab Light chain 9606
133 4TOY 1 H 35O22 Fab Heavy chain 9606
134 4TOY 2 L 35O22 Fab Light chain 9606
135 4TUO 1 A, C Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
136 4TUO 2 B, D Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
137 3NPS 2 B S4 FAB HEAVY CHAIN 9606
138 3NPS 3 C S4 FAB LIGHT CHAIN 9606
139 5I4F 1 A scFv 2D10 10090
140 1RUR 1 L immunoglobulin 13G5, light chain fab 10090
141 1RUR 2 H immunoglobulin 13G5, heavy chain fab 10090
142 5VAA 1 A, B Ig gamma-2A chain C region, A allele UNP residues 107-330 10090
143 5ADO 1 H FAB A.17 HEAVY CHAIN 9606
144 5ADO 2 L FAB A.17 LIGHT CHAIN 9606
145 5WN9 1 H scFv 2D10 9606
146 4XC3 1 L 4E10 Fab light chain 9606
147 4XC3 2 H 4E10 Fab heavy chain 9606
148 1X9Q 1 A 4m5.3 anti-fluorescein single chain antibody fragment antibody binding fragment 9606
149 4M5Y 1 H, I Fab 5J8 heavy chain 9606
150 4M5Y 2 L, M Fab 5J8 light chain 9606
151 4TQE 1 L If kappa light chain 10090
152 4TQE 2 H Fab heavy chain 10090
153 2BNU 1 A T-CELL RECEPTOR ALPHA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-91 9606
154 2BNU 2 B T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR DOMAINS, RESIDUES 1-130 9606
155 4ISV 1 A 1C2 FAB LIGHT CHAIN 10090
156 4ISV 2 B 1C2 FAB HEAVY CHAIN 10090
157 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
158 4XC1 2 H 4E10 FAB HEAVY CHAIN 9606
159 5VSI 1 H CH1/Ckappa Fab heavy chain 9606
160 5VSI 2 L CH1/Ckappa Fab light chain 9606
161 4CMH 2 B HEAVY CHAIN OF SAR650984-FAB FRAGMENT 10090
162 4CMH 3 C LIGHT CHAIN OF SAR650984-FAB FRAGMENT 10090
163 5JXA 1 H VRC03 Heavy chain 9606
164 5JXA 2 L VRC03 Light chain 9606
165 3QHZ 1 H, I Human monoclonal antibody del2D1, Fab Heavy Chain Fab Heavy Chain 9606
166 3QHZ 2 L, M Human monoclonal antibody del2D1, Fab Light Chain Fab Light Chain 9606
167 3UJI 1 L Light chain of anti-HIV-1 V3 monoclonal antibody 2558 9606
168 3UJI 2 H Fab region of the heavy chain of anti-HIV-1 V3 monoclonal antibody 2558 9606
169 3NTC 1 L Fab light chain 10090
170 3NTC 2 H Fab heavy chain 10090
171 4YNY 1 A, C Heavy chain of antigen binding fragment, Fab 10116
172 4YNY 2 B, D Light chain of antigen binding fragment, Fab 10116
173 4TUK 1 H Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
174 4TUK 2 L Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
175 4YO0 1 A, C Heavy chain of antigen binding fragment, Fab 10116
176 4YO0 2 B, D Light chain of antigen binding fragment, Fab 10116
177 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
178 6AZM 2 B, D 580 germline antibody, heavy chain Fragment: Fab 9606
179 6BE3 1 H Fab (F598) Heavy Chain 9606
180 6BE3 2 L Fab (F598) Light Chain 9606
181 6FUN 1 A Huamn F11 T-Cell Receptor alpha chain 9606
182 6FUN 2 B Human F11 T-Cell Receptor beta chain 9606
183 4NWU 1 H APE1551 Ab Fab heavy chain 9606
184 4NWU 2 L APE1551 Ab Fab light chain 9606
185 1KGC 1 D T-cell receptor alpha chain 9606
186 1KGC 2 E T-cell receptor beta chain 9606
187 3HC4 1 H IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
188 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
189 6FRC 1 A Human T-Cell Receptor F11 alpha Chain 9606
190 6FRC 2 B Human T-Cell Receptor beta Chain 9606
191 5VZR 1 A, H G4 antibody heavy chain Fab fragment 10090
192 5VZR 2 B, L G4 antibody light chain Fab fragment 10090
193 2W9D 1 H ICSM 18-ANTI-PRP THERAPEUTIC FAB HEAVY CHAIN 10090
194 2W9D 2 L ICSM 18-ANTI-PRP THERAPEUTIC FAB LIGHT CHAIN 10090
195 5EWI 1 H VRC38.01 Heavy Chain 9606
196 5EWI 2 L VRC38.01 Light Chain 9606
197 5E2W 1 L AT8 LIGHT CHAIN 10090
198 5E2W 2 H AT8 HEAVY CHAIN 10090
199 5MYK 1 A Fab c#17 light chain 10090
200 5MYK 2 B Fab c#17 heavy chain 10090
201 6FUQ 1 A Human F11 T-Cell Receptor 9606
202 6FUQ 2 B Human F11 T-Cell Receptor beta chain 9606
203 4NZR 1 H PGT135 heavy chain Fab 9606
204 4NZR 2 L PGT135 light chain Fab 9606
205 5MYO 1 A, C Fab c#6 light chain 10090
206 5MYO 2 B, D Fab c#6 heavy chain 10090
207 4HBC 1 H Antigen Binding Fragment, Immunoglobulin IgG - Heavy Chain 9986
208 4HBC 2 L Antigen Binding Fragment, Immunoglobulin IgG - Light Chain 9986
209 4AEH 1 H FAB ANTIBODY, HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-231 10090
210 4AEH 2 L FAB ANTIBODY, LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-214 10090
211 5UEL 1 H 354NC102 Fab Heavy Chain 9606
212 5UEL 2 L 354NC102 Fab Light Chain 9606
213 3UZQ 1 A anti-dengue Mab 4E11 Single chain variable fragment 10090
214 2V17 2 H MONOCLONAL ANTIBODY FAB FRAGMENT MN423 DISULPHIDE BRIDGE BETWEEN L214 AND H137 IS REDUCED 10090
215 2V17 3 L MONOCLONAL ANTIBODY FAB FRAGMENT MN423 DISULPHIDE BRIDGE BETWEEN L214 AND H137 IS REDUCED 10090
216 4J6R 2 H HEAVY CHAIN OF ANTIBODY VRC23 9606
217 4J6R 3 L LIGHT CHAIN OF ANTIBODY VRC23 9606
218 5E2V 1 L AT8 LIGHT CHAIN 10090
219 5E2V 2 H AT8 HEAVY CHAIN 10090
220 5SY8 1 H 10E8 FAB HEAVY CHAIN 9606
221 5SY8 2 L 10E8 FAB LIGHT CHAIN 9606
222 5DD1 1 H ANTI-HIV ANTIBODY DH570 FAB HEAVY CHAIN 9544
223 5DD1 2 L ANTI-HIV ANTIBODY DH570 FAB LIGHT CHAIN 9544
224 5JUE 1 L light chain of UIC2 Fab 10090
225 5JUE 2 H heavy chain of UIC2 Fab 10090
226 5CIN 1 H FAB 4E10 HEAVY CHAIN 9606
227 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
228 5A2J 1 H SCFV-SM3 CONTAINS BOTH H AND L CHAINS OF SCFV-SM3, CONNECTEDBY A LINKER. CHAIN L RESIDUES ARE NUMBERED FROM 1000. RESIDUES 6-115,20-129 10090
229 5JR1 1 H 10E8 heavy chain 9606
230 5JR1 2 L 10E8 mature light chain 9606
231 5VF6 1 A single chain variable fragment 9031
232 3CFB 1 A, L BLUE FLUORESCENT ANTIBODY EP2-19G2-KAPPA LIGHT CHAIN FAB 10090
233 3CFB 2 B, H BLUE FLUORESCENT ANTIBODY EP2-19G2-IGG2B HEAVY CHAIN FAB 10090
234 3WII 1 L, M anti-human ROBO1 antibody B2212A Fab light chain 10090
235 3WII 2 H, I anti-human ROBO1 antibody B2212A Fab heavy chain 10090
236 6FR9 1 A T-Cell Receptor F11 alpha chain 9606
237 6FR9 2 B T-Cell Receptor F11 beta chain 9606
238 5OB5 2 H fAb Heavy chain 9606
239 5OB5 3 L fAb Light chain 9606
240 3BKJ 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
241 3BKJ 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
242 5I66 1 A 8B6 antibody, heavy chain 10090
243 5I66 2 B 8B6 antibody, light chain 10090
244 4JAM 1 A, H ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN of CH103 9606
245 4JAM 2 B, L ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN of CH103 9606
246 3QQ9 1 C, L 101F LIGHT CHAIN 10090
247 3QQ9 2 D, H 101F HEAVY CHAIN 10090
248 5TKK 2 H mouse antibody vFP5.01 heavy chain 10090
249 5TKK 3 L mouse antibody vFP5.01 light chain 10090
250 5FGB 1 A, B Anti-HCV E2 Fab HC84-1 light chain 9606
251 5FGB 2 C, E Anti-HCV E2 Fab HC84-1 heavy chain 9606
252 5W6C 1 H UCA Fab heavy chain 9606
253 5W6C 2 L UCA Fab light chain 9606
254 5I1K 1 L FAB LIGHT CHAIN 9606
255 5I1K 2 H FAB HEAVY CHAIN 9606
256 3OZ9 1 L Fab NC-1 kappa light chain 10090
257 3OZ9 2 H Fab NC-1 IgG2a heavy chain 10090
258 4JDV 1 A, H Fab heavy chain NIH45-46 Germ-line HEAVY CHAIN, IG GAMMA-1 CHAIN 9606
259 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
260 5V7U 1 L CBTAU-22.1 Fab light chain 9606
261 5V7U 2 H CBTAU-22.1 Fab heavy chain 9606
262 5UEA 1 A, H Fab Heavy Chain 9606
263 5UEA 3 B, L Fab Light Chain 9606
264 4AL8 2 H FAB 2H12 HEAVY CHAIN 9606
265 4AL8 3 L FAB 2H12 LIGHT CHAIN 9606
266 3G5Y 1 A 175 light chain 10090
267 3G5Y 2 B 175 heavy chain 10090
268 5NMV 1 L Fab light chain 10088
269 5NMV 2 H Fab heavy chain 10088
270 4N8C 1 H, I Heavy chain of monoclonal antibody 10090
271 4N8C 2 L, M Light chain of monoclonal antibody 10090
272 5AZ2 1 H anti-human epiregulin antibody 9E5 Fab heavy chain 10090
273 5AZ2 2 L anti-human epiregulin antibody 9E5 Fab light chain 10090
274 4HGW 1 A Antibody Fab fragment, light chain 10090
275 4HGW 2 B Antibody Fab fragment, heavy chain 10090
276 1NLB 1 L antibody 19D9D6 light chain 10090
277 1NLB 2 H antibody 19D9D6 heavy chain 10090
278 1C5C 1 L CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 103-214) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-102) IS FROM MURINE SOURCE FAB 10090
279 1C5C 2 H CHIMERIC DECARBOXYLASE ANTIBODY 21D8 THE CONSTANT DOMAIN (RESIDUES 109-230) IS FROM HUMAN SOURCE, AND THE VARIABLE DOMAIN (RESIDUES 1-108) IS FROM MURINE SOURCE FAB 10090
280 3VFG 1 L 3F8 Light Chain 10090
281 3VFG 2 H 3F8 Heavy Chain 10090
282 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
283 5TDN 2 B, D anti-HER2 Fab Heavy Chain 9606
284 3QRG 1 L Fab light chain 9606
285 3QRG 2 H Fab heavy chain Fd fragment 9606
286 5M6A 1 A, B, C, D Bence-Jones light chain 9606
287 4LLY 2 B, D light chain Clambda 9606
288 4EBQ 1 H anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, heavy chain Fab 10090
289 4EBQ 2 L anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, light chain 10090
290 5EZI 1 H Fab c12 heavy chain 9606
291 5EZI 2 L Fab c12 Light chain 9606
292 5U66 2 A IgG1 fc derived from CD4-fc fusion 9606
293 4K23 1 H anti-uPAR antibody, heavy chain 10090
294 4K23 2 L anti-uPAR antibody, light chain 10090
295 3NCJ 1 L Fab15 Mut8 light chain 9606
296 3NCJ 2 H Fab15 Mut8 heavy chain 9606
297 3UO1 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
298 3UO1 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
299 4M1G 1 L Murine IgG2a A27D7 Light chain Fab domain 10090
300 4M1G 2 H Murine IgG2a A27D7 Heavy chain Fab domain 10090
301 5W05 1 L M59 FAB LIGHT CHAIN 10090
302 5W05 2 H M59 FAB HEAVY CHAIN FD 10090
303 2IPU 1 K, L IgG2a Fab fragment Heavy Chain 10090
304 2IPU 2 G, H IgG2a Fab fragment Light Chain Kappa 10090
305 3HC3 1 H IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
306 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
307 4M61 1 A, C Fab A52 light chain 10090
308 4M61 2 B, D Fab A52 heavy chain 10090
309 3BKM 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
310 3BKM 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
311 1UM5 1 L Antibody 21H3 L chain 10090
312 1UM5 2 H Antibody 21H3 H chain 10090
313 3QHF 1 H Human monoclonal antibody del2D1, Fab Heavy Chain Fab Heavy Chain 9606
314 3QHF 2 L Human monoclonal antibody del2D1, Fab Light Chain Fab Light Chain 9606
315 4NWT 1 L APE1531 Ab Fab light chain 9606
316 4NWT 2 H APE1531 Ab Fab heavy chain 9606
317 3WHX 1 A mAb Fab H fragment 10090
318 3WHX 2 B mAb Fab L fragment 10090
319 3NA9 1 L Fab15 light chain 9606
320 3NA9 2 H Fab15 heavy chain 9606
321 3BAE 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
322 3BAE 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
323 6FUO 1 A Human F11 T-Cell Receptor alpha chain 9606
324 6FUO 2 B Human F11 T-Cell Receptor 9606
325 1NGZ 1 A Germline Metal Chelatase Catalytic Antibody, Light chain germline Fab fragment 10090
326 1NGZ 2 B Germline Metal Chelatase Catalytic Antibody, Heavy chain germline Fab fragment 10090
327 4LRI 1 A, B MSL-109 Light Chain 9606
328 4LRI 2 C, P MSL-109 Heavy Chain 9606
329 4ZTP 1 L Light chain of Fab fragment of rabbit monoclonal antibody R53 9986
330 4ZTP 2 H Heavy chain of Fab fragment of rabbit monoclonal antibody R53 9986
331 4JN2 1 A, L anti dabigatran Fab 10090
332 4JN2 2 B, H anti dabigatran Fab 10090
333 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
334 4XBE 2 H 4E10 Fab heavy chain 9606
335 1MJ8 1 L IMMUNOGLOBULIN MS6-126 Fab Fragment, LIGHT CHAIN 10090
336 1MJ8 2 H IMMUNOGLOBULIN MS6-126 Fab Fragment, HEAVY CHAIN 10090
337 6BE2 1 H Fab (F598) Heavy Chain 9606
338 6BE2 2 L Fab (F598) Light Chain 9606
339 4EI6 1 A, C Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
340 4EI6 2 B, D Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain) extracellular domain (SEE REMARK 999) 10090
341 4JFZ 1 L Fab light chain 9606
342 4JFZ 2 H Fab heavy chain 9606
343 3WIF 1 A mAb Fab H fragment 10090
344 3WIF 2 B mAb Fab L fragment 10090
345 5U6A 1 A Light Chain 9606
346 5U6A 2 B Heavy Chain 9606
347 5KVD 2 L ZV-2 Antibody Fab Light Chain 10090
348 5KVD 3 H ZV-2 Antibody Fab Heavy Chain 10090
349 3MBX 1 L X836 LIGHT CHAIN 10090
350 3MBX 2 H X836 HEAVY CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN, FD fragment 10090
351 3TWC 1 L PGT127 light chain, Ig lambda-2 chain C regions 9606
352 3TWC 2 H PGT127 heavy chain, Ig gamma-1 chain C region 9606
353 6APC 1 H Epididymis luminal protein 214 9606
354 6APC 2 L IGL@ protein 9606
355 4HHA 1 A Fab KE5 Fab fragment KE5 9606
356 4HHA 2 B Antibody KE5 AD-2S1 eptiope 9606
357 5A2K 1 H IG LAMBDA-1 CHAIN V REGION S43 RESIDUES 6-115,20-129 10090
358 4RGO 2 H 14G8 heavy chain Fab 10090
359 4RGO 3 L 14G8 light chain Fab 10090
360 5GRY 1 A, G diabody 9606
361 5UEK 2 H Fab 12E Heavy Chain 9606
362 5UEK 3 L Fab 12E Light Chain 9606
363 3NAA 1 L Fab15 Mut5 light chain 9606
364 3NAA 2 H Fab15 Mut5 heavy chain 9606
365 1Q0X 1 L Fab 9B1, light chain 10090
366 1Q0X 2 H Fab 9B1, heavy chain 10090
367 4R90 1 L Anti CD70 Llama glama Fab 27B3 Light chain 9844
368 4R90 2 H Anti CD70 Llama glama Fab 27B3 Heavy chain 9844
369 4XVT 2 H donor 45 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Heavy chain 9606
370 4XVT 3 L 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain 9606
371 5IK3 1 A, C 1E03 Fab fragment heavy chain 9606
372 5IK3 2 B, D 1E03 Fab fragment light chain 9606
373 5NPH 2 H Heavy chain of Fab fragment derived from non-neutralizing antibody DAO5 10090
374 5NPH 3 L Light chain of Fab fragment derived from non-neutralizing antibody DAO5 10090
375 5IHZ 1 A, C, E, H 1E01 Fab fragment heavy chain 9606
376 5IHZ 2 B, D, F, L 1E01 Fab fragment light chain 9606
377 2R1X 1 A Fab, antibody fragment (IgG1k), light chain 10090
378 2R1X 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
379 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
380 5U3D 2 B MEMAB TRASTUZUMAB FAB HEAVY CHAIN 9606
381 4WUK 1 H CH65 heavy chain 9606
382 4WUK 2 L CH65 light chain 9606
383 3MLY 1 L, M Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain 9606
384 3MLY 2 H, I Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain 9606
385 5U3O 1 H DH511.2_K3 Fab Heavy Chain 9606
386 5U3O 2 L DH511.2_K3 Fab Light Chain 9606
387 5JOP 1 D, L Fab 14.22 light chain 10090
388 5JOP 2 E, H Fab14.22 heavy chain 10090
389 4HPO 1 H CH58 Fab heavy chain 9606
390 4HPO 2 L CH58 Fab light chain 9606
391 6FUP 1 A Human F11 T-cell Receptor alpha Chain 9606
392 6FUP 2 B Huamn F11 T-Cell Receptor beta chain 9606
393 5UKN 1 H DH522UCA Fab fragment heavy chain 9544
394 5UKN 2 L DH522UCA Fab fragment light chain 9544
395 6BHZ 1 H, I Trastuzumab Anti-HER2 Fab Heavy Chain 9606
396 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
397 5IT2 1 H heavy chain 9606
398 5IT2 2 L light chain 9606
399 5JIH 1 A, B Ig gamma-1 chain C region Hinge-CH2-CH3, UNP Residues 108-329 9606
400 4POZ 1 C light chain of Fab fragment of 10B9 antibody 10090
401 4POZ 2 D heavy chain of Fab fragment of 10B9 antibody 10090
402 4F57 1 L Light chain of Fab of a neutralizing antibody L1 light chain of L1 9606
403 4F57 2 H Heavy chain of Fab of a neutralizing antibody L1 heavy chain of L1 9606
404 2W59 1 A, B IGY FCU3-4 9031
405 1L6X 1 A IMMUNOGLOBULIN GAMMA-1 HEAVY CHAIN CONSTANT REGION Fc Fragment, Residues 119-325 9606
406 5GZ0 1 A, C FM329 light chain 1383439
407 5GZ0 2 B, D FM329 heavy chain 1383439
408 6BQB 1 L MGG4 Fab light chain 9606
409 6BQB 2 H MGG4 Fab heavy chain 9606
410 4PUB 1 H DX-2930 HEAVY CHAIN 9606
411 4PUB 2 L DX-2930 LIGHT CHAIN 9606
412 6B14 1 H Heavy chain of Fab BL3-6S97N 10090
413 6B14 2 L Light chain of Fab BL3-6S97N 10090
414 5DD6 1 A, H ANTI-HIV ANTIBODY DH570.mut58 FAB HEAVY CHAIN 9544
415 5DD6 2 B, L ANTI-HIV ANTIBODY DH570.mut58 FAB LIGHT CHAIN 9544
416 5TEZ 4 I TCR F50 alpha chain 9606
417 5TEZ 5 J TCR F50 beta chain 9606
418 3WIH 2 L, M anti-human ROBO1 antibody B2212A Fab light chain 10090
419 3WIH 3 H, I anti-human ROBO1 antibody B2212A Fab heavy chain 10090
420 5GS3 1 A, H diabody protein 9606
421 4DZB 1 A Valpha7.2-Jalpha33 (MAIT T cell receptor) 9606
422 4DZB 2 B Vbeta2 (MAIT T cell receptor) 9606
423 3CFC 1 H BLUE FLUORESCENT ANTIBODY EP2-19G2-IGG2B HEAVY CHAIN FAB 10090
424 3CFC 2 L BLUE FLUORESCENT ANTIBODY EP2-19G2-KAPPA LIGHT CHAIN FAB 10090
425 3V4U 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
426 3V4U 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
427 5VKD 2 H Fab Heavy Chain 9606
428 5VKD 3 L Fab light chain 9606
429 2R1Y 1 A Fab, antibody fragment (IgG1k), light chain 10090
430 2R1Y 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
431 5XHG 1 A, C polypeptide(L) 562
432 5XHG 2 B, D polypeptide(H) 562
433 4XMP 2 H HEAVY CHAIN OF ANTIBODY VRC08 9606
434 4XMP 3 L LIGHT CHAIN OF ANTIBODY VRC08 9606
435 3UYR 1 H antibody Fab heavy chain 10090
436 3UYR 2 L antibody Fab light chain 10090
437 3V0W 1 L WN1 222-5 Fab (IgG2a) light chain 10090
438 3V0W 2 H WN1 222-5 Fab (IgG2a) heavy chain 10090
439 1YQV 1 L HyHEL-5 Antibody Light Chain IG*G1 FAB FRAGMENT (HY/HEL-5) 10090
440 1YQV 2 H HyHEL-5 Antibody Heavy Chain IG*G1 FAB FRAGMENT (HY/HEL-5) 10090
441 3OAZ 1 H, M Fab 2G12, heavy chain Fab 9606
442 3OAZ 2 K, L Fab 2G12, light chain 9606
443 2R2B 1 A Fab, antibody fragment (IgG1k), light chain 10090
444 2R2B 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
445 1ZAN 1 L Fab AD11 Light Chain 10116
446 1ZAN 2 H Fab AD11 Heavy Chain 10116
447 4BSV 1 A HETERODIMERIC FC ANTIBODY AZYMETRIC VARIANT 2 IG GAMMA 1 FC DOMAIN, RESIDUES 106-330 9606
448 4BSV 2 B HETERODIMERIC FC ANTIBODY AZYMETRIC VARIANT 2 IG GAMMA 1 FC DOMAIN, RESIDUES 106-330 9606
449 4N0Y 1 H IGH526 Heavy Chain 9606
450 4N0Y 2 L IGH526 Light Chain 9606
451 3V52 1 H ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN 10090
452 3V52 2 L ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 L CHAIN 10090
453 3GGW 1 A, C FAB F22-4 LIGHT CHAIN 10090
454 3GGW 2 B, D FAB F22-4 HEAVY CHAIN 10090
455 1BEC 1 A 14.3.D T CELL ANTIGEN RECEPTOR 10090
456 1RZF 1 L Fab E51 light chain 9606
457 1RZF 2 H Fab E51 heavy chain 9606
458 4KTE 1 H GE148 Heavy Chain Fab Fab fragment 9544
459 4KTE 2 L GE148 Light Chain Fab 9544
460 5I8O 1 H HMM5 antibody heavy chain 9606
461 5I8O 2 L HMM5 antibody light chain 9606
462 4OUO 1 A anti Bla g 1 scFv 9031
463 4JG0 1 L Fab light chain 9606
464 4JG0 2 H Fab heavy chain 9606
465 4YGV 1 A, F aDabi-Fab2a heavy chain 9606
466 4YGV 2 B, L aDabi-Fab2a light chain 9606
467 5U4R 1 A, H VRC 315 53-1A09 Fab Heavy chain 9606
468 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
469 5ALC 1 H ANTI-TICAGRELOR FAB 72, HEAVY CHAIN 9606
470 5ALC 2 L ANTI-TICAGRELOR FAB 72, LIGHT CHAIN 9606
471 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
472 5U5F 2 B MEMAB TRASTUZUMAB FAB HEAVY CHAIN 9606
473 3EO0 1 A, C GC-1008 Fab Light Chain 10090
474 3EO0 2 B, D GC-1008 Fab Heavy Chain 10090
475 5CIL 1 H FAB 4E10 HEAVY CHAIN 9606
476 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
477 6BI2 1 H, I Trastuzumab Anti-HER2 Fab Heavy Chain 9606
478 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
479 5F3B 1 A, E RK35 Chimeric antibody heavy chain 10090
480 5F3B 2 B, F RK35 Chimeric antibody light chain 10090
481 6FUR 1 A, C Human F11 T-Cell Receptor alpha chain 9606
482 6FUR 2 B, D Human F11 T-Cell Receptor 9606
483 4FQI 3 H antibody CR9114 heavy chain Fab 9606
484 4FQI 4 L antibody CR9114 light chain Fab Lambda 9606
485 6FUM 1 A Human F11 T-Cell Receptor alpha chain 9606
486 6FUM 2 B Human F11 T-Cell Receptor beta chain 9606
487 4JHA 1 H D25 antigen-binding fragment heavy chain 9606
488 4JHA 2 L D25 light chain 9606
489 3MCL 1 L C706 MONOCLONAL LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
490 3MCL 2 H C706 MONOCLONAL HEAVY CHAIN FD fragment of the heavy chain, CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
491 4PTT 1 A Antibody pn132p2C05, light chain 9606
492 4PTT 2 B Antibody pn132p2C05, heavy chain 9606
493 5KVL 1 H Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) heavy chain Fab fragment 9606
494 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
495 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
496 5TDO 2 B, D anti-HER2 Fab Heavy Chain 9606
497 8FAB 1 A, C IGG1-LAMBDA HIL FAB (LIGHT CHAIN) 9606
498 8FAB 2 B, D IGG1-LAMBDA HIL FAB (HEAVY CHAIN) 9606
499 5NHW 1 H anti-human ActRII Bimagrumab Fab heavy-chain C-terminal FLAG-His6 tag Fab heavy-chain 9606
500 5NHW 2 L anti-human ActRII Bimagrumab Fab light-chain Fab light-chain 9606
501 5M02 3 G Protein Trav14-1,T-cell receptor alpha chain C region 10090
502 5M02 4 H T-cell receptor beta chain V region C5,T-cell receptor beta-2 chain C region 10090
503 2ZPK 1 L, M IgG1-lambda P20.1 Fab (light chain) 10090
504 2ZPK 2 H, I IgG1-lambda P20.1 Fab (heavy chain) Variable and Constant region 10090
505 4DGV 1 H HCV1 Heavy Chain Fab 9606
506 4DGV 2 L HCV1 Light Chain 9606
507 2DQU 1 L IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
508 2DQU 2 H IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
509 5TH2 1 A, C cetuximab Fab, light chain 10090
510 5TH2 2 B, D cetuximab Fab, heavy chain 10090
511 4W4O 1 A, B Ig gamma-1 chain C region UNP residues 107-330 9606
512 5I8K 1 L HHH1 Fab Light chain 9606
513 5I8K 2 H HHH1 Fab Heavy chain 9606
514 4YDL 2 B, H HEAVY CHAIN OF ANTIBODY C38-VRC18.02 9606
515 4YDL 3 C, L LIGHT CHAIN OF ANTIBODY C38-VRC18.02 9606
516 3T4Y 1 A S25-2 FAB (IGG1K) LIGHT CHAIN 10090
517 3T4Y 2 B S25-2 FAB (IGG1K) HEAVY CHAIN 10090
518 1YNL 1 L Ig gamma light chain 10090
519 1YNL 2 H Ig gamma heavy chain 10090
520 5EPM 1 A, E Antibody Fab fragment heavy chain 10090
521 5EPM 2 B, F Antibody Fab fragment light chain 10090
522 2AJS 1 L Antibody 7A1 FAB' IMMUNOGLOBULIN IGG1 kappa light chain 10090
523 2AJS 2 H Antibody 7A1 FAB' IMMUNOGLOBULIN IGG1 HEAVY CHAIN 10090
524 5VH5 1 A Infliximab Fc 10090
525 3UMT 1 A scFv heavy chain and light chain 10090
526 3BZ4 1 A, C, E, G Fab F22-4 light chain 10090
527 3BZ4 2 B, D, F, H Fab F22-4 heavy chain 10090
528 4NUJ 1 A PGT152 light chain 9606
529 4NUJ 2 B PGT152 heavy chain 9606
530 3LIZ 2 L 4C3 monoclonal antibody Light Chain 10090
531 3LIZ 3 H 4C3 monoclonal antibody Heavy Chain 10090
532 1RUA 1 L immunoglobulin igg2a, light chain fab 10090
533 1RUA 2 H immunoglobulin igg2a, heavy chain fab 10090
534 3U2S 1 A, H PG9 heavy chain antigen-binding fragment 9606
535 3U2S 2 B, L PG9 light chain 9606
536 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
537 5D6C 2 B, H 4497 antibody IgG1 (VH and CH1) 9606
538 4GAG 1 H NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN 10090
539 4GAG 2 L NEUTRALIZING ANTIBODY AP33 LIGHT CHAIN 10090
540 2R23 1 A Fab, antibody fragment (IgG1k), light chain 10090
541 2R23 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
542 5JII 1 A, B Ig gamma-1 chain C region Hinge-CH2-CH3, UNP Residues 108-329 9606
543 4NUG 1 L PGT151 light chain 9606
544 4NUG 2 H PGT151 heavy chain 9606
545 3IU4 1 H chP3 Fab heavy chain 10090
546 3IU4 2 L chP3 Fab light chain 10090
547 3MNZ 2 A ANTI-HIV-1 ANTIBODY 13H11 LIGHT CHAIN mouse Fv,human Fc 10090
548 3MNZ 3 B ANTI-HIV-1 ANTIBODY 13H11 HEAVY CHAIN mouse Fv,human Fc 10090
549 3MLR 1 L Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain 9606
550 3MLR 2 H Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain 9606
551 1QYG 1 L FAB M82G2, LIGHT CHAIN 10090
552 1QYG 2 H FAB M82G2, HEAVY CHAIN 10090
553 1P7K 1 A, L antibody light chain FAB 10090
554 1P7K 2 B, H antibody heavy chain FAB 10090
555 3RVV 2 C 4C1 - light chain 10090
556 3RVV 3 D 4C1 - heavy chain 10090
557 5A2L 1 H SCFV-SM3 RESIDUES 6-115,20-129 10090
558 3P0Y 2 H Fab DL11 heavy chain 9606
559 3P0Y 3 L Fab DL11 light chain 9606
560 4NPY 1 A, L germline PGT121 light chain Fab 9606
561 4NPY 2 B, H germline PGT121 heavy chain Fab 9606
562 6ANA 2 H LL2 Fab Heavy Chain 10090
563 6ANA 3 L LL2 Fab Light Chain 10090
564 5IBU 1 B, L 6652 Light Chain 9606
565 5IBU 2 G, H 6652 Heavy Chain 9606
566 6FRA 1 A Human T-Cell Receptor F11 alpha Chain 9606
567 6FRA 2 B Human T-Cell Receptor F11 beta Chain 9606
568 5VPL 2 C 4C1 - LIGHT CHAIN 10090
569 5VPL 3 D 4C1 - HEAVY CHAIN 10090
570 6AOD 1 A FXIa Antibody FAB Light Chain 9606
571 6AOD 2 B FXIa Antibody FAB Heavy Chain 9606
572 5WCD 1 H VRC315 04-1D02 Fab Heavy chain 9606
573 5WCD 2 L VRC315 04-1D02 Fab Light chain 9606
574 2YPV 2 H FAB 12C1 10090
575 2YPV 3 L FAB 12C1 10090
576 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
577 4HH9 2 B, D Fab KE5, heavy chain KE5 Heavy Chain 9606
578 4JY5 1 L PGT122 light chain Fab 9606
579 4JY5 2 H PGT122 heavy chain Fab 9606
580 6ELE 1 A, H fAB heavy chain 9606
581 6ELE 2 B, L fAB light chain 9606
582 5UR8 1 A human immunoglobulin gamma, heavy chain Fd fragment 9606
583 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
584 6B5R 1 H CIS42 Fab Heavy chain 9606
585 6B5R 2 L CIS42 Fab Light chain 9606
586 5W38 1 A, B Immunoglobulin heavy constant gamma 3 Fc domain, UNP residues 155-377 9606
587 3NAC 1 L Fab15 Mut7 light chain 9606
588 3NAC 2 H Fab15 Mut7 heavy chain 9606
589 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
590 5U5M 2 B MEMAB TRASTUZUMAB, HEAVY CHAIN 9606
591 2DQT 1 L IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
592 2DQT 2 H IMMUNOGLOBULIN 6D9 FAB FRAGMENT 10090
593 1Q72 1 L Fab M82G2, Light chain 10090
594 1Q72 2 H Fab M82G2, Heavy chain 10090
595 4M1D 1 L, M Fab mAb 447-52D Light Chain 9606
596 4M1D 2 H, I Fab mAb 447-52D Heavy Chain 9606
597 1SEQ 1 L Monoclonal Antibody MNAC13 FAB Light Chain 10090
598 1SEQ 2 H Monoclonal Antibody MNAC13 FAB Heavy Chain 10090
599 4YHO 1 H aDabi-Fab3 heavy chain 9606
600 4YHO 2 L aDabi-Fab3 light chain 9606
601 2R1W 1 A Fab, antibody fragment (IgG1k), light chain 10090
602 2R1W 2 B Fab, antibody fragment (IgG1k), heavy chain 10090
603 3MO1 1 A ANTI-HIV-1 ANTIBODY 13H11 LIGHT CHAIN FUSION PROTEIN between mouse Fv and a human Fc 10090
604 3MO1 2 B ANTI-HIV-1 ANTIBODY 13H11 HEAVY CHAIN FUSION PROTEIN between mouse Fv and a human Fc 10090
605 4DGY 1 H HCV1 Heavy Chain Fab 9606
606 4DGY 2 L HCV1 Light Chain 9606
607 6EH6 1 A Human T Cell Receptor Alpha Chain 9606
608 6EH6 2 B Human T Cell Receptor BetaChain 9606
609 5EN2 1 A GD01 heavy chain 10090
610 5EN2 2 B GD01 light chain 10090
611 3T77 1 A S25-2 FAB (IGG1K) light chain 10090
612 3T77 2 B S25-2 FAB (IGG1K) heavy chain 10090
613 3MXW 2 L 5E1 light chain 9606
614 3MXW 3 H 5E1 heavy chain 9606
615 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
616 2V7N 2 B, D, F, H IMMUNOGLOBULIN HEAVY CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-259 32630
617 3EO9 1 L Efalizumab Fab fragment, light chain 9606
618 3EO9 2 H Efalizumab Fab fragment, heavy chain 9606
619 4ALA 2 H FAB 2H12 HEAVY CHAIN 10090
620 4ALA 3 L FAB 2H12 LIGHT CHAIN 10090
621 4F33 1 A, C, E, G MORAb-009 FAB light chain 10090
622 4F33 2 B, D, F, H MORAb-009 FAB heavy chain 10090
623 3C6S 1 A, C, E, G Fab F22-4 light chain 10090
624 3C6S 2 B, D, F, H Fab F22-4 heavy chain 10090
625 5WUV 1 L light chain 9606
626 5WUV 2 H heavy chain 9606
627 4Z8F 1 H S1-15 Fab (IgG2b) heavy chain 10090
628 4Z8F 2 L S1-15 Fab (IgG2b kappa) light chain 10090
629 3OKL 1 A S25-39 Fab (IgG1k) light chain 10090
630 3OKL 2 B S25-39 Fab (IgG1k) heavy chain 10090
631 2BNQ 4 D T-CELL RECEPTOR ALPHA CHAIN V REGION CONTAINS ALSO C (CONSTANT) REGION 9606
632 2BNQ 5 E T-CELL RECEPTOR BETA CHAIN C REGION EXTRACELLULAR, RESIDUES 1-130 9606
633 4JM4 1 H PGT 135 Heavy Chain Fab 9606
634 4JM4 2 L PGT 135 Light Chain Fab 9606
635 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
636 2HWZ 2 H Immunoglobulin Fab heavy chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
637 6B0G 1 C 1245 Antibody, Light Chain 9606
638 6B0G 2 D 1245 Antibody, Heavy Chain 9606
639 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
640 5TDP 2 B, D anti-HER2 Fab Heavy Chain 9606
641 1ZEA 1 L monoclonal anti-cholera toxin IGG1 KAPPA antibody, L chain 10090
642 1ZEA 2 H monoclonal anti-cholera toxin IGG1 KAPPA antibody, H chain 10090
643 4WNQ 1 A, C TCR Variable Delta 1 chain and TCR constant Alpha chain 9606
644 4WNQ 2 B, D TCR Variable Beta 2 (TRBV20) chain and TCR constant Beta chain 9606
645 2Q86 2 B, D Vbeta8.2 extracellular domain 10090
646 6BE4 1 H Fab (F598) Heavy Chain 9606
647 6BE4 2 L Fab(F598) Light Chain 9606
648 6FRB 1 A Human T-Cell Receptor F11 alpha chain 9606
649 6FRB 2 B Human T-Cell Receptor F11 beta Chain 9606
650 5TPP 1 L DH270.5 Fab heavy chain 9606
651 5TPP 2 H DH270.5 Fab light chain 9606
652 5L88 1 H Anti-afamin antibody N14, Fab fragment, heavy chain 10090
653 5L88 2 L Anti-afamin antibody N14, Fab fragment, light chain 10090
654 1Q9W 1 A, C S45-18 Fab (IgG1k) light chain Fab1 Light chain kappa 10090
655 1Q9W 2 B, D S45-18 Fab (IgG1k) heavy chain Fab1 Heavy chain g1 10090
656 4P3C 1 H Heavy Chain Fab fragment of antibody LEM-2/15 MT1-MMP V-B loop 10090
657 4P3C 2 L Light Chain Fab fragment of antibody LEM-2/15 10090
658 5D7K 1 D MAV36 TCR Alpha Chain 9606
659 5D7K 2 E MAV36 TCR Beta Chain 9606
660 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
661 1L7I 2 H chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence heavy chain (residues 1-216) 9606
662 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
663 1JPT 2 H immunoglobulin Fab D3H44, heavy chain Fab fragment 9606
664 1AQK 1 L FAB B7-15A2 IMMUNOGLOBULIN HUMAN FAB FAB 9606
665 1AQK 2 H FAB B7-15A2 IMMUNOGLOBULIN HUMAN FAB FAB 9606
666 5TL5 1 L M2177 LIGHT CHAIN 10090
667 5TL5 2 H M2177 HEAVY CHAIN 10090
668 2FX7 1 L Fab 4E10 Light Chain 9606
669 2FX7 2 H Fab 4E10 Heavy Chain 9606
670 5W5N 1 A, B Immunoglobulin heavy constant gamma 4 Sigma2 Fc fragment, UNP residues 106-327 9606
671 5Y9K 1 L belimumab light chain 9606
672 5Y9K 2 H belimumab heavy chain 9606
673 4DTG 1 L Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain 9606
674 4DTG 2 H Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, heavy chain 9606
675 5CSZ 1 A, H GANTENERUMAB FAB FRAGMENT HEAVY CHAIN FAB 9606
676 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
677 3WFH 1 A mAb Fab H fragment 10090
678 3WFH 2 B mAb Fab L fragment 10090
679 4K3D 1 H, I BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN 9913
680 4K3D 2 L, M BOVINE ANTIBODY WITH ULTRALONG CDR H3, LIGHT CHAIN 9913
681 4H8W 2 H FAB HEAVY CHAIN OF ADCC AND NON-NEUTRALIZING ANTI-HIV-1 ANTIBODY N5-I5 9606
682 4H8W 3 L FAB LIGHT CHAIN OF ADCC AND NON-NEUTRALIZING ANTI-HIV-1 ANTIBODY N5-I5 9606
683 3HNT 1 H CS-35 Fab Heavy Chain Heavy Chain 10090
684 3HNT 2 L CS-35 Fab Light Chain Light Chain 10090
685 5HYF 1 A Ig gamma-1 chain C region Knob protein UNP residues 104-330 9606
686 1WEJ 1 L E8 ANTIBODY IGG1 KAPPA MOUSE MONOCLONAL ANTIBODY FAB 10090
687 1WEJ 2 H E8 ANTIBODY IGG1 KAPPA MOUSE MONOCLONAL ANTIBODY FAB 10090
688 5VPG 2 C FAB 4C1 - LIGHT CHAIN 10090
689 5VPG 3 D FAB 4C1 - HEAVY CHAIN 10090
690 5HI4 2 C, H CAT-2000 FAB heavy chain 9606
691 5HI4 3 D, L CAT-2000 FAB light chain 9606
692 5NUZ 1 A, H eOD01 heavy chain Fab fragment (domains: variable heavy and constant heavy 1) Fab fragment (domains: variable heavy and constant heavy 1) 10090
693 5NUZ 2 B, L eOD01 light chain Fab fragment (domains: variable light and constant light) Fab fragment (domains: variable light and constant light) 10090
694 5FCU 2 H JR4 FAB HEAVY CHAIN 9544
695 5FCU 3 L JR4 FAB LIGHT CHAIN 9544
696 3RVW 2 C 4C1 - light chain 10090
697 3RVW 3 D 4C1 - heavy chain 10090
698 5DD3 1 H ANTI-HIV ANTIBODY DH570.4 FAB HEAVY CHAIN 9544
699 5DD3 2 L ANTI-HIV ANTIBODY DH570.4 FAB LIGHT CHAIN 9544
700 4C54 1 A, B IG GAMMA-4 CHAIN C REGION FC FRAGMENT, RESIDUES 114-327 9606
701 5XKU 2 B HNIgGA6 light chain 9606
702 5XKU 3 C HNIgGA6 heavy chain 9606
703 4W4N 1 A, B Ig gamma-1 chain C region UNP residues 107-329 9606
704 3D85 1 A FAB of antibody 7G10, light chain light chain 9606
705 3D85 2 B FAB of antibody 7G10, heavy chain heavy chain 9606
706 4Z95 1 H S1-15 Fab (IgG2b) heavy chain 10090
707 4Z95 2 L S1-15 Fab (IgG2b) light chain 10090
708 5HI5 2 C, H CAT-2000 FAB heavy chain 9606
709 5HI5 3 D, L CAT-2000 light chain 9606
710 5JO5 1 A, C, E, H 10E8 gHV 9606
711 5JO5 2 B, D, F, L 10E8 gLV 9606
712 5L9D 1 H MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN 10090
713 5L9D 2 L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN 10090
714 5CCK 1 H Antibody 3BC315 Fab heavy chain 9606
715 5CCK 2 L Antibody 3BC315 Fab light chain 9606
716 3VXS 3 D H27-14 TCR alpha chain 9606
717 3VXS 4 E H27-14 TCR beta chain 9606
718 5I76 1 A, C FM318_light_chain 1383439
719 5I76 2 B, D FM318_heavy_cahin 1383439
720 1KCV 1 L PC282 IMMUNOGLOBULIN light chain 10090
721 1KCV 2 H PC282 IMMUNOGLOBULIN heavy chain 10090
722 1FLR 1 L 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT 10090
723 1FLR 2 H 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT 10090
724 5I18 1 L FAB LIGHT CHAIN 9606
725 5I18 2 H FAB HEAVY CHAIN 9606
726 4JN1 1 H anti-dabigatran Fab1, heavy chain 10090
727 4JN1 2 L anti-dabigatran Fab1, light chain 10090
728 4P3D 1 A, H Heavy Chain Fab fragment of antibody LEM-2/15 10090
729 4P3D 2 B, L Light Chain Fab fragment of antibody LEM-2/15 10090
730 4G5Z 1 H canakinumab antibody fragment heavy chain 9606
731 4G5Z 2 L canakinumab antibody fragment light chain 9606
732 3TNM 1 A, H Fab heavy chain of human anti-HIV-1 Env antibody A32 9606
733 3TNM 2 B, L Fab light chain of human anti-HIV-1 Env antibody A32 9606
734 2OK0 2 L Fab ED10 light chain 10090
735 2OK0 3 H Fab ED10 heavy chain 10090
736 3SOB 1 L antibody light chain 9606
737 3SOB 3 H antibody heavy chain 9606
738 6B5M 1 H CIS43 Fab Heavy chain 9606
739 6B5M 2 L CIS43 Fab Light chain 9606
740 5AWN 1 H Heavy chain of 3BC176 Fab 9606
741 5AWN 2 L Light chain of 3BC176 Fab 9606
742 4ZFO 2 L J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
743 4ZFO 3 A, H J22.9-xi Fab, Heavy Chain Fab Heavy Chain fragment of anti-BCMA antibody J22.9-xi 10090
744 4ZFO 4 B J22.9-xi Fab, Light Chain Fab Light Chain fragment of anti-BCMA antibody J22.9-xi 10090
745 4G6M 2 H heavy chain of gevokizumab antibody binding fragment 10090
746 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
747 5DR5 1 H AbD09097 Fab heavy chain The Fab heavy chain contains a C-terminal Myc- and hexahistidine extension preceded by thrombin peptidase recognition sequence to facilitate detection and purification 9606
748 5DR5 2 L AbD09097 Fab light chain 9606
749 2IH3 1 A FAB Heavy Chain 10090
750 2IH3 2 B FAB Light Chain 10090
751 2P5E 4 D T-Cell Receptor, Alpha Chain 9606
752 2P5E 5 E Hypothetical protein 9606
753 4KQ3 1 L CNTO3186 light chain Fab 9606
754 4KQ3 2 H CNTO3186 heavy chain Fab 9606
755 6AQ7 2 H POM6 FAB Heavy CHAIN 10090
756 6AQ7 3 L POM6 FAB light CHAIN 10090
757 4JFX 1 A, L Fab light chain 9606
758 4JFX 2 B, H Fab heavy chain 9606
759 3SGE 1 I, L Light Chain 10090
760 3SGE 2 H, J Heavy Chain 10090
761 1BM3 1 L IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN CONSTANT DOMAIN 10090
762 1BM3 2 H IMMUNOGLOBULIN OPG2 FAB, VARIABLE DOMAIN VARIABLE DOMAIN 10090
763 4TUJ 1 A, C Heavy chain of monoclonal antibody against neuroblastoma associated antigen 10090
764 4TUJ 2 B, D Light chain of monoclonal antibody against neuroblastoma associated antigen 10090
765 4L4V 3 D, G MAIT T-cell receptor alpha chain 9606
766 4L4V 4 E, H MAIT T-cell receptor beta chain 9606
767 2VXQ 2 H FAB H CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
768 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
769 2XWT 1 A THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 HEAVY CHAIN FAB FRAGMENT HEAVY CHAIN, RESIDUES 1-229 9606
770 2XWT 2 B THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 LIGHT CHAIN FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-213 9606
771 5FHB 1 H Antibody 100 Fab heavy chain 9606
772 5FHB 2 L Antibody 100 Fab light chain 9606
773 3HZM 1 A S73-2 Fab (IgG1k) light chain 10090
774 3HZM 2 B S73-2 Fab (IgG1k) heavy chain 10090
775 1JGU 1 L Antibody Light Chain 10090
776 1JGU 2 H Antibody Heavy Chain 10090
777 4I77 1 H Lebrikizumab heavy chain Fab 9606
778 4I77 2 L Lebrikizumab light chain Fab 9606
779 4OCR 1 L CAP256-VRC26.01 light chain Fab 9606
780 4OCR 2 H CAP256-VRC26.01 heavy chain Fab 9606
781 4O4Y 1 L 2095-2 light chain SEE REMARK 999 9986
782 4O4Y 2 H 2095-2 heavy chain 9986
783 3Q5Y 1 A, B, C, D TCR N15 beta 10090
784 5OBF 1 H fAb Heavy chain 10090
785 5OBF 2 L fAb Light chain 10090
786 5LGH 1 H MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN IGG1-KAPPA HEAVY CHAIN, 1-214 10090
787 5LGH 2 L MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA LIGHT CHAIN IGG1-KAPPA LIGHT CHAIN, 1-214 10090
788 1UZ8 1 A, L IGG FAB (IGG3, KAPPA) LIGHT CHAIN 291-2G3-A FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-212 10090
789 1UZ8 2 B, H IGG FAB (IGG3, KAPPA) HEAVY CHAIN 291-2G3-A FAB FRAGMENT HEAVY CHAIN, RESIDUES 1-213 10090
790 1DQQ 1 A, C ANTI-LYSOZYME ANTIBODY HYHEL-63 (LIGHT CHAIN) FAB FRAGMENT 10090
791 1DQQ 2 B, D ANTI-LYSOZYME ANTIBODY HYHEL-63 (HEAVY CHAIN) FAB FRAGMENT 10090
792 5L7X 1 H Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain IgG1-kappa heavy chain, 1-214 10090
793 5L7X 2 L Mouse Antibody Fab Fragment, IgG1-kappa Light Chain IgG1-kappa light chain, 1-214 10090
794 5V6M 1 L Light chain of Fab fragment of rabbit anti-HIV1 gp120 V3 mAb 10A3 9986
795 5V6M 2 H Heavy chain of Fab fragment of rabbit anti-HIV1 gp120 V3 mAb 10A3 9986
796 4GLR 2 H, J anti-ptau heavy chain heavy chain 9031
797 4GLR 3 I, K anti-ptau light chain light chain 9031
798 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
799 5WK3 2 Q, S, U, W M116 HEAVY CHAIN FD 9606
800 2VUO 1 A, B IG GAMMA CHAIN C REGION FC FRAGMENT, RESIDUES 229-447 9986
801 4HJG 1 A Trastuzumab light chain 9606
802 4HJG 2 B Trastuzumab heavy chain 9606
803 5OWP 1 H Ig heavy chain V-III region J606,Ig lambda-1 chain V region H2020 10090
804 4M43 1 L Fragment antigen-binding 523-11 light chain 10090
805 4M43 2 H Fragment antigen-binding 523-11 heavy chain 10090
806 5I30 1 L Fab PL-2 light chain 10090
807 5I30 2 H Fab PL-2 heavy chain 10090
808 3HC0 1 A, H IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
809 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
810 3BKC 1 L WO2 IgG2a Fab fragment Light Chain Kappa 10090
811 3BKC 2 H WO2 IgG2a Fab fragment Heavy Chain 10090
812 3FN0 1 L Fab Z13e1 light chain 9606
813 3FN0 2 H Fab Z13e1 heavy chain 9606
814 5X5X 1 H Fd chain of anti-osteocalcin antibody KTM219 10090
815 5X5X 2 L L chain of anti-osteocalcin antibody KTM219 10090
816 4YHI 1 A, H aDabi-Fab2a heavy chain 9606
817 4YHI 2 B, L aDabi-Fab2a light chain 9606
818 4OSU 1 H SM5-1 Fab Heavy Chain 9606
819 4OSU 2 L SM5-1 Fab Light Chain 9606
820 3MXV 1 L fab fragment of anti-Shh 5E1 mouse/human chimera, light chain 10090
821 3MXV 2 H fab fragment of anti-Shh 5E1 mouse/human chimera, heavy chain 10090
822 5IFA 1 H VRC01c-HuGL2 Fab heavy chain 9606
823 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
824 5U6Q 2 B, D MAIT T-cell receptor alpha chain 9606
825 5U6Q 3 E, G MAIT T-cell receptor beta chain 9606
826 1T2Q 1 L Fab NNA7 Heavy Chain 10090
827 1T2Q 2 H Fab NNA7 Light Chain 10090
828 6ELJ 1 A, H fAB heavy chain 9606
829 6ELJ 2 B, L fAB light chain 9606
830 5W5M 1 A, B Immunoglobulin heavy constant gamma 4 Sigma1 Fc fragment, UNP residues 106-327 9606
831 4G6K 1 H heavy chain of gevokizumab antibody binding fragment 10090
832 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
833 4MAU 1 L C2244 light chain SEE REMARK 999 10090
834 4MAU 2 H C2244 heavy chain FD, SEE REMARK 999 10090
835 3LEX 1 A, H 11f10 Antibody Heavy Chain 10090
836 3LEX 2 B, L 11f10 Antibody Light Chain 10090
837 6EH7 1 A Human T Cell Receptor Alpha Chain AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSE QDDKIIFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPS 9606
838 6EH7 2 B Human T Cell Receptor Beta Chain 9606
839 6B0W 1 L 1710 antibody, light chain 9606
840 6B0W 2 H 1710 antibody, heavy chain 9606
841 1OP3 1 K, L FAB 2G12, light chain light chain 9606
842 1OP3 2 H, M FAB 2G12, heavy chain heavy chain 9606
843 5VH4 1 A, H Infliximab Fab Heavy Chain 10090
844 5VH4 2 B, L Infliximab Fab Light Chain 10090
845 5DQD 1 L S55-5 Fab (IgG1 kappa) light chain 10090
846 5DQD 2 H S55-5 Fab (IgG1) heavy chain 10090
847 4PJE 3 E, G TCR-alpha 9606
848 4PJE 4 F, H TCR-beta 9606
849 5DT1 1 H Fab Heavy chain of broadly neutralizing antibody VRC26.25 9606
850 5DT1 2 L Fab Light chain of broadly neutralizing antibody VRC26.25 9606
851 4ONF 1 H 3D6 FAB ANTIBODY HEAVY CHAIN 10090
852 4ONF 2 L 3D6 FAB ANTIBODY LIGHT CHAIN 10090
853 1OPG 1 L OPG2 FAB (LIGHT CHAIN) 9606
854 1OPG 2 H OPG2 FAB (HEAVY CHAIN) 9606
855 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
856 1JPS 2 H immunoglobulin Fab D3H44, heavy chain Fab fragment 9606
857 5NPJ 1 A, B Single chain variable fragment of the non-neutralizing antibody DAO5 10090
858 1NBY 1 A antibody kappa light chain first chain of Anti-Lysozyme Antibody HyHEL-63 light chain 10090
859 1NBY 2 B immunoglobulin gamma 1 chain second chain of Anti-Lysozyme Antibody HyHEL-63 10090
860 3V6O 2 C, D Monoclonal antibody 9F8 fab fragment Heavy chain Fab fragment of monoclonal antibody H chain 10090
861 3V6O 3 E, F Monoclonal antibody 9F8 fab fragment Light chain Fab fragment of monoclonal antibody L chain 10090
862 3S96 1 A, C 3B5H10 FAB heavy chain 10090
863 3S96 2 B, D 3B5H10 FAB light chain 10090
864 4LKX 1 A Fab fragment heavy chain 9606
865 4LKX 2 B Fab fragment light chain 9606
866 1Q9O 1 B, D S45-2 Fab (IgG1k) heavy chain Fab1 Heavy chain g1 10090
867 1Q9O 2 A, C S45-2 Fab (IgG1k) light chain Fab1 Light chain kappa 10090
868 3SE8 2 H Heavy chain of antibody VRC03 Antigen binding fragement of antibody heavy chain 9606
869 3SE8 3 L Light chain of antibody VRC03 antibody light chain 9606
870 5JW5 1 A, H MEDI8852 Heavy chain 9606
871 5JW5 2 B, L MEDI8852 Light chain 9606
872 5VH3 1 A, H Infliximab Fab Heavy Chain 10090
873 5VH3 2 B, L Infliximab Fab Light Chain 10090
874 5HDQ 2 H Fab Heavy Chain 10090
875 5HDQ 3 L Fab Light Chain 10090
876 4FQ2 1 H Fab heavy chain 9606
877 4FQ2 2 L Fab light chain 9606
878 3RKD 2 C, L Monoclonal Antibody, Light Chain 10090
879 3RKD 3 D, H Monoclonal Antibody, Heavy Chain 10090
880 4MS8 1 C 42F3 alpha 10090
881 4MS8 2 D 42F3 beta 10090
882 3L1O 1 H MONOCLONAL ANTIBODY FAB FRAGMENT MN423 H CHAIN 10090
883 3L1O 2 L MONOCLONAL ANTIBODY FAB FRAGMENT MN423 L CHAIN 10090
884 2A77 1 L Immunoglobulin Light Chain 10090
885 2A77 2 H Immunoglobulin Heavy Chain 10090
886 2FB4 1 L IGG1-LAMBDA KOL FAB (LIGHT CHAIN) 9606
887 2FB4 2 H IGG1-LAMBDA KOL FAB (HEAVY CHAIN) 9606
888 3GO1 1 L Fab 268-D, light chain 9606
889 3GO1 2 H Fab 268-D, heavy chain 9606
890 1F3D 1 J, L CATALYTIC ANTIBODY 4B2 LIGHT CHAIN - FAB FRAGMENT 10090
891 1F3D 2 H, K CATALYTIC ANTIBODY 4B2 HEAVY CHAIN - FAB FRAGMENT 10090
892 4G9F 4 D beta chain C12C TCR 9606
893 4G9F 5 E beta chain C12C TCR 9606
894 3QWO 1 B, L motavizumab light chain 10090
895 3QWO 2 A, H motavizumab heavy chain 10090
896 3CVI 1 H 25-D1.16 Heavy chain 10090
897 3CVI 2 L 25-D1.16 Light chain 10090
898 1PZ5 1 A Light chain of Fab (SYA/J6) 10090
899 1PZ5 2 B Heavy chain of Fab (SYA/J6) 10090
900 1LK3 2 L, M 9D7 Light Chain Fab fragment, Residues 1-210 10116
901 1LK3 3 H, I 9D7 Heavy Chain Fab fragment, Residues 1-219 10116
902 4IOI 1 A Trastuzumab light chain 9606
903 4IOI 2 B Trastuzumab heavy chain 9606
904 1N7M 1 H Germline Metal Chelatase Catalytic Antibody, chain H 10090
905 1N7M 2 L Germline Metal Chelatase Catalytic Antibody, chain L 10090
906 4OKV 1 A, C heavy chain of 8H7 mAb 10090
907 4OKV 2 B, D light chain of 8H7 mAb 10090
908 6B5S 1 H CIS42 Fab Heavy chain 9606
909 6B5S 2 L CIS42 Fab Light chain 9606
910 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
911 5K8A 2 B, F, H, V Heavy chain 10090
912 1JGV 1 L Antibody Light Chain 10090
913 1JGV 2 H Antibody Heavy Chain 10090
914 5VAG 2 B Light chain of antibody m826 9606
915 5VAG 3 C Heavy chain of antibody m826 9606
916 3MLX 1 L, M Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain 9606
917 3MLX 2 H, I Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain 9606
918 3I9G 1 H Sonepcizumab antibody Fab fragment, heavy chain Fab Fragment 10090
919 3I9G 2 L Sonepcizumab antibody Fab fragment, light chain Fab Fragment 10090
920 5GIR 1 A, H Heavy chain of Fab fragment 10090
921 5GIR 2 B, L Light chain of Fab fragment 10090
922 2ADF 2 H 82D6A3 IgG FAB 10090
923 2ADF 3 L 82D6A3 IgG FAB 10090
924 5I16 1 A, L FAB LIGHT CHAIN 9606
925 5I16 2 B, H FAB HEAVY CHAIN 9606
926 3O41 1 B, L Mouse monoclonal antibody 101F Fab light chain 10090
927 3O41 2 A, H Mouse monoclonal antibody 101F Fab heavy chain 10090
928 1SVZ 1 A, B single-chain Fv fragment 1696 scFv1696 10090
929 5F9O 2 H CH235.9 Heavy chain 9606
930 5F9O 3 L CH235.09 Light chain 9606
931 3Q6G 1 L, M Light chain of Fab of rhesus mAb 2.5B 9544
932 3Q6G 2 H, I Heavy chain of Fab of rhesus mAb 2.5B 9544
933 5W5L 1 A, B Immunoglobulin gamma-1 heavy chain Sigma Fc fragment, UNP residues 227-449 9606 2.7.11.22 | Details
934 1UM4 1 L Antibody 21H3 L chain 10090
935 1UM4 2 H Antibody 21H3 H chain 10090
936 5VJQ 1 A, C, E, G HyHEL10 heavy chain Fab fragment carrying three mutations; I29F, S52T, Y53F DEL-I 10090 3.2.1.18 | Details
937 5VJQ 2 B, D, F, H HyHEL10 light chain Fab fragment 10090
938 4RBP 1 K, L Fab 2G12 light chain 9606
939 4RBP 2 H, M Fab 2G12 heavy chain 9606
940 3I75 1 A